AK1 (Homo sapiens)
Description [+]
- Synonyms: AK1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Adenylate kinase isoenzyme 1 (AK 1)(EC 2.7.4.3)(ATP-AMP transphosphorylase 1)(Myokinase) [Source:UniProtKB/Swiss-Prot;Acc:P00568]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK1-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 29 | 185 |
Protein sequence [+]
AK1 | Homo sapiens | 9606 | length:210
MGCCSSSDPRREDDLRAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLR
SEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEE
FERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFY
EKRGIVRKVNAEGSVDSVFSQVCTHLDALK
SEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEE
FERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFY
EKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007050 | cell cycle arrest | biological_proccess | IEA |
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0046034 | ATP metabolic process | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004017 | adenylate kinase activity | mollecular_function | TAS |
GO:0019206 | nucleoside kinase activity | mollecular_function | EXP |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | EXP |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :361
- Gene related info from GeneCards [?] : AK1
- Ensembl genome browser [?] : ENSG00000106992
- Expression info from Arrayexpress [?] : ENSG00000106992
- Protein expression from Protein Atlas: [?] ENSG00000106992
- Community gene edition from Wikigenes: [?] 203
- OMIM gene information: 103000
- OMIM disease information:
Click on [?] for more information.