GAPDHS (Homo sapiens)
Description [+]
- Synonyms: GAPDHS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12)(Spermatogenic glyceraldehyde-3-phosphate dehydrogenase)(Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2)(GAPDH-2) [Source:UniProtKB/Swiss-Prot;Acc:O14556]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GAPDHS-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 76 | 224 |
PFAM A | Gp_dh_C | 229 | 386 |
Protein sequence [+]
GAPDHS | Homo sapiens | 9606 | length:408
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPP
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY
DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS
DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF
GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG
DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY
DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS
DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF
GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG
DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0045821 | positive regulation of glycolysis | biological_proccess | TAS |
GO:0030317 | sperm motility | biological_proccess | ISS |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0007286 | spermatid development | biological_proccess | IEA |
GO:0030317 | sperm motility | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | TAS |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0009434 | microtubule-based flagellum | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0019861 | flagellum | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :24864
- Gene related info from GeneCards [?] : GAPDHS
- Ensembl genome browser [?] : ENSG00000105679
- Expression info from Arrayexpress [?] : ENSG00000105679
- Protein expression from Protein Atlas: [?] ENSG00000105679
- Community gene edition from Wikigenes: [?] 26330
- OMIM gene information: 609169
- OMIM disease information:
Click on [?] for more information.