Q8HZD8_9PRIM (Gorilla gorilla)
Description [+]
- Synonyms: Q8HZD8_9PRIM
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Gorilla gorilla
- Short gene description: SubName: Full=Tumor necrosis factor; Flags: Fragment; [Source:Uniprot/SPTREMBL;Acc:Q8HZD8]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q8HZD8_9PRIM-G_gorilla
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 102 | 233 |
Protein sequence [+]
Q8HZD8_9PRIM | Gorilla gorilla | 9593 | length:233
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EXFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLXRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
EXFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLXRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0007254 | JNK cascade | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0042742 | defense response to bacterium | biological_proccess | IEA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0001932 | regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006959 | humoral immune response | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0045123 | cellular extravasation | biological_proccess | IEA |
GO:0050900 | leukocyte migration | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045994 | positive regulation of translational initiation by iron | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0002740 | negative regulation of cytokine secretion during immune response | biological_proccess | IEA |
GO:0000187 | activation of MAPK activity | biological_proccess | IEA |
GO:0043193 | positive regulation of gene-specific transcription | biological_proccess | IEA |
GO:0001934 | positive regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0016481 | negative regulation of transcription | biological_proccess | IEA |
GO:0050901 | leukocyte tethering or rolling | biological_proccess | IEA |
GO:0051044 | positive regulation of membrane protein ectodomain proteolysis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0048661 | positive regulation of smooth muscle cell proliferation | biological_proccess | IEA |
GO:0032715 | negative regulation of interleukin-6 production | biological_proccess | IEA |
GO:0050995 | negative regulation of lipid catabolic process | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0030730 | sequestering of triglyceride | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0045071 | negative regulation of viral genome replication | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0002439 | chronic inflammatory response to antigenic stimulus | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0032800 | receptor biosynthetic process | biological_proccess | IEA |
GO:0050796 | regulation of insulin secretion | biological_proccess | IEA |
GO:0034116 | positive regulation of heterotypic cell-cell adhesion | biological_proccess | IEA |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IEA |
GO:0060559 | biological_proccess | IEA | |
GO:0060557 | biological_proccess | IEA | |
GO:0060555 | biological_proccess | IEA | |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0055037 | recycling endosome | cell_component | IEA |
GO:0001891 | phagocytic cup | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGGOG00000006018
- Expression info from Arrayexpress [?] : ENSGGOG00000006018
- Protein expression from Protein Atlas: [?] ENSGGOG00000006018
Click on [?] for more information.