AK2 (Gorilla gorilla)
Description [+]
- Synonyms: AK2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Gorilla gorilla
- Short gene description: Adenylate kinase isoenzyme 2, mitochondrial (AK 2)(EC 2.7.4.3)(ATP-AMP transphosphorylase 2) [Source:UniProtKB/Swiss-Prot;Acc:P54819]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK2-G_gorilla
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 20 | 206 |
PFAM A | ADK_lid | 142 | 177 |
Protein sequence [+]
AK2 | Gorilla gorilla | 9593 | length:239
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIRRITGRLIHPXSGRSYXXEFNPPKXPMKDDITGEPLIRRSXDNE
KALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIRRITGRLIHPXSGRSYXXEFNPPKXPMKDDITGEPLIRRSXDNE
KALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Structure links:
- Prosite motif and domain information: PS00113
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005743 | mitochondrial inner membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGGOG00000000069
- Expression info from Arrayexpress [?] : ENSGGOG00000000069
- Protein expression from Protein Atlas: [?] ENSGGOG00000000069
Click on [?] for more information.