NP_001006390.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001006390.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: v-yes-1 Yamaguchi sarcoma viral related oncogene homolog [Source:RefSeq_peptide;Acc:NP_001006390]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001006390.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 46 | 101 |
PFAM A | SH3_2 | 47 | 101 |
PFAM A | SH2 | 109 | 191 |
PFAM A | Pkinase | 227 | 480 |
PFAM A | Pkinase_Tyr | 227 | 477 |
Protein sequence [+]
NP_001006390.1 | Gallus gallus | 9031 | length:492
MGCIKSKRKANLHGDGLDLKNQPANTDAHLLPGQIFANEETEEHGVIVVALYPYDGLHED
DLSFKKGEKLKVIEELGEWWKARSLTTKKEGFIPSNYVAKVNTLETEEWFFKDITRKDAE
RQLLAPGNGPGAFLIRESETLKGSYSLSIRDYDPQHGDVIKHYKIRSLDNGGFYISPRIT
FPSINDMIKHYQKQSDGLCRKLEKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGE
VWMGYYHNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITE
FMAKGSLLDFLKSDEGSRLMLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSDLLM
CKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLYEIVTYG
KIPYPGMSNSDVMVALQRGYRMPRMETCPAELYDIMKTCWKDKAKERPTFDYLQSVLDDF
YTATEGQYQQQP
DLSFKKGEKLKVIEELGEWWKARSLTTKKEGFIPSNYVAKVNTLETEEWFFKDITRKDAE
RQLLAPGNGPGAFLIRESETLKGSYSLSIRDYDPQHGDVIKHYKIRSLDNGGFYISPRIT
FPSINDMIKHYQKQSDGLCRKLEKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGE
VWMGYYHNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITE
FMAKGSLLDFLKSDEGSRLMLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSDLLM
CKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLYEIVTYG
KIPYPGMSNSDVMVALQRGYRMPRMETCPAELYDIMKTCWKDKAKERPTFDYLQSVLDDF
YTATEGQYQQQP
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00220
- Smartdomain prediction information: SM00219
- Prosite motif and domain information: PS00133
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007242 | intracellular signaling cascade | biological_proccess | IEA |
GO:0018108 | peptidyl-tyrosine phosphorylation | biological_proccess | IEA |
GO:0050853 | B cell receptor signaling pathway | biological_proccess | IEA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0030218 | erythrocyte differentiation | biological_proccess | IEA |
GO:0009725 | response to hormone stimulus | biological_proccess | IEA |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004181 | metallocarboxypeptidase activity | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000018967
- Expression info from Arrayexpress [?] : ENSGALG00000018967
- Protein expression from Protein Atlas: [?] ENSGALG00000018967
- entrezgene: 431409
- entrezgene: 421127
- refseq_dna: NM_001006390
- refseq_peptide: NP_001006390
Click on [?] for more information.