BID_CHICK (Gallus gallus)
Description [+]
- Synonyms: BID_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: BH3-interacting domain death agonist. [Source:UniProtKB/Swiss-Prot;Acc:Q8JGM8]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BID_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | BID | 1 | 193 |
Protein sequence [+]
BID_CHICK | Gallus gallus | 9031 | length:193
MEQDIYSNGSDHMERMLLFAFLAESSGCEFKEQLPSLQSQGVLCSVKDALCYDSDGELQT
DGNRSGHLQNGELVPDPEVNEAIVRTIAAQLAEIGDQLDKQIKAKVVNDLVQHFLNENLP
REEITRCLSQAVEGLARAIPSDLEQEKAMLVLAMLLTKKVANQMPSLLQRVFSTTVNYIS
QHFHNYIVRMLRE
DGNRSGHLQNGELVPDPEVNEAIVRTIAAQLAEIGDQLDKQIKAKVVNDLVQHFLNENLP
REEITRCLSQAVEGLARAIPSDLEQEKAMLVLAMLLTKKVANQMPSLLQRVFSTTVNYIS
QHFHNYIVRMLRE
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
| GO:0006626 | protein targeting to mitochondrion | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0005737 | cytoplasm | cell_component | IEA |
| GO:0005739 | mitochondrion | cell_component | IEA |
| GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000013039
- Expression info from Arrayexpress [?] : ENSGALG00000013039
- Protein expression from Protein Atlas: [?] ENSGALG00000013039
Click on [?] for more information.
