NP_001006227.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001006227.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: mitogen-activated protein kinase 11 [Source:RefSeq_peptide;Acc:NP_001006227]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001006227.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 1 | 269 |
PFAM A | Pkinase_Tyr | 1 | 249 |
Protein sequence [+]
NP_001006227.1 | Gallus gallus | 9031 | length:323
SAYDTKTRQKVAVKKLSRPFQSLIHARRTYRELRLLKHMKHENVIGLLDVFTPATSIENF
NEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVN
EDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKG
KALFPGDDYIDQLKRIMEVVGTPSSELLKKISSEHARKYIESLPHMPQQDLKAVFRGANP
LAVDLLEKMLILDSDKRITASAALAHPYFVQYHDPDDEPEAELYDESIENKERTIEEWKE
LTYEEVMSFKPPDLKMDSLEIEQ
NEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVN
EDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKG
KALFPGDDYIDQLKRIMEVVGTPSSELLKKISSEHARKYIESLPHMPQQDLKAVFRGANP
LAVDLLEKMLILDSDKRITASAALAHPYFVQYHDPDDEPEAELYDESIENKERTIEEWKE
LTYEEVMSFKPPDLKMDSLEIEQ
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | ISS |
GO:0007243 | protein kinase cascade | biological_proccess | ISS |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0008092 | cytoskeletal protein binding | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | ISS |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000008612
- Expression info from Arrayexpress [?] : ENSGALG00000008612
- Protein expression from Protein Atlas: [?] ENSGALG00000008612
- entrezgene: 417739
- entrezgene: 429882
- entrezgene: 425466
- refseq_dna: NM_001006227
- refseq_peptide: NP_001006227
Click on [?] for more information.