XR_026669.1 (Gallus gallus)
Description [+]
- Synonyms: XR_026669.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: PREDICTED: Gallus gallus similar to ectodysplasin A1 (LOC769069), mRNA. [Source:RefSeq_dna;Acc:XR_026669]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: XR_026669.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 237 | 350 |
Protein sequence [+]
XR_026669.1 | Gallus gallus | 9031 | length:356
PAAMGAERRGEAARGGCSCAGAGSWRLFLGFFALSLALHVLPLGCYLELRSKLRRDRGPQ
PAAPPRRDGTAAAAAPGASARRPPVCPSEGGVVVPELALLNFFHPEEKLHVGEGRRVRRN
KRSKGSEGPDGPSSVKNKKKGKKAGPPGPNGPQGPPGPPGPQGPPGIPGIPGIPGTTVMG
PPGPPGPPGPQGPPGLQGPSGATDKAGSRDTQPAVVHLQGQGSAIQVKNDLSGGVLNDWS
RITMNPKVFKLHARSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRS
IETGKTNFNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGDAPAS
PAAPPRRDGTAAAAAPGASARRPPVCPSEGGVVVPELALLNFFHPEEKLHVGEGRRVRRN
KRSKGSEGPDGPSSVKNKKKGKKAGPPGPNGPQGPPGPPGPQGPPGIPGIPGIPGTTVMG
PPGPPGPPGPQGPPGLQGPSGATDKAGSRDTQPAVVHLQGQGSAIQVKNDLSGGVLNDWS
RITMNPKVFKLHARSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRS
IETGKTNFNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGDAPAS
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001942 | hair follicle development | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007160 | cell-matrix adhesion | biological_proccess | IEA |
GO:0007431 | salivary gland development | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0043473 | pigmentation | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005102 | receptor binding | mollecular_function | IEA |
GO:0005789 | endoplasmic reticulum membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0045177 | apical part of cell | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000004481
- Expression info from Arrayexpress [?] : ENSGALG00000004481
- Protein expression from Protein Atlas: [?] ENSGALG00000004481
Click on [?] for more information.