CALR (Equus caballus)
Description [+]
- Synonyms: CALR
- Species: Equus caballus
- Short gene description: Calreticulin Precursor (CRP55)(Calregulin)(HACBP)(ERp60)(grp60) [Source:UniProtKB/Swiss-Prot;Acc:P27797]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CALR-E_caballus
Structure & Sequence [+]
Protein sequence [+]
CALR | Equus caballus | 9796 | length:412
MLLPAPLLLGLLGLVAAEPAIYFKEQFLDGDGWAERWIESKHKSDFGKFILSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPNAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDGNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEADKDDEDDKEEDEEDEEDEEEDAAGQAKDEL
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPNAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDGNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEADKDDEDDKEEDEEDEEDEEEDAAGQAKDEL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0007050 | cell cycle arrest | biological_proccess | IEA |
GO:0006611 | protein export from nucleus | biological_proccess | IEA |
GO:0045740 | positive regulation of DNA replication | biological_proccess | IEA |
GO:0033144 | negative regulation of steroid hormone receptor signaling pathway | biological_proccess | IEA |
GO:0045665 | negative regulation of neuron differentiation | biological_proccess | IEA |
GO:0048387 | negative regulation of retinoic acid receptor signaling pathway | biological_proccess | IEA |
GO:0010149 | senescence | biological_proccess | IEA |
GO:0045787 | positive regulation of cell cycle | biological_proccess | IEA |
GO:0030866 | cortical actin cytoskeleton organization | biological_proccess | IEA |
GO:0050766 | positive regulation of phagocytosis | biological_proccess | IEA |
GO:0040020 | regulation of meiosis | biological_proccess | IEA |
GO:0002502 | peptide antigen assembly with MHC class I protein complex | biological_proccess | IEA |
GO:0016564 | transcription repressor activity | mollecular_function | IEA |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0050681 | androgen receptor binding | mollecular_function | IEA |
GO:0003729 | mRNA binding | mollecular_function | IEA |
GO:0008937 | ferredoxin reductase activity | mollecular_function | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005788 | endoplasmic reticulum lumen | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0005844 | polysome | cell_component | IEA |
GO:0042824 | MHC class I peptide loading complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000008164
- Expression info from Arrayexpress [?] : ENSECAG00000008164
- Protein expression from Protein Atlas: [?] ENSECAG00000008164
Click on [?] for more information.