Q29484_HORSE (Equus caballus)
Description [+]
- Synonyms: Q29484_HORSE
- Species: Equus caballus
- Short gene description: Cellular tumor antigen p53 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q29484]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q29484_HORSE-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53 | 1 | 165 |
PFAM A | P53_tetramer | 194 | 235 |
Protein sequence [+]
Q29484_HORSE | Equus caballus | 9796 | length:269
YSPTLNKLFCQLAKTCPVQLLVSSPPPPGTRVRAMAIYKKSEFMTEVVRRCPHHERCSDS
SDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMG
GMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRST
KRVLSSNTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEPGGSKA
HSSHLKSKKGQSTSSHKKLIFKREGPDSD
SDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMG
GMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRST
KRVLSSNTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEPGGSKA
HSSHLKSKKGQSTSSHKKLIFKREGPDSD
Structure links:
- Prosite motif and domain information: PS00348
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0002309 | T cell proliferation during immune response | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0006289 | nucleotide-excision repair | biological_proccess | IEA |
GO:0006302 | double-strand break repair | biological_proccess | IEA |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006461 | protein complex assembly | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0006983 | ER overload response | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0007369 | gastrulation | biological_proccess | IEA |
GO:0007406 | negative regulation of neuroblast proliferation | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0008104 | protein localization | biological_proccess | IEA |
GO:0008156 | negative regulation of DNA replication | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0009792 | embryonic development ending in birth or egg hatching | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0010552 | positive regulation of specific transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0031571 | G1 DNA damage checkpoint | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0042149 | cellular response to glucose starvation | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0009303 | rRNA transcription | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0051276 | chromosome organization | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0030330 | DNA damage response, signal transduction by p53 class mediator | biological_proccess | IEA |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0034644 | cellular response to UV | biological_proccess | IEA |
GO:0000739 | DNA strand annealing activity | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0005507 | copper ion binding | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0047485 | protein N-terminus binding | mollecular_function | IEA |
GO:0051087 | chaperone binding | mollecular_function | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0010843 | promoter binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005626 | insoluble fraction | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | IEA |
GO:0005657 | replication fork | cell_component | IEA |
GO:0005730 | nucleolus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0016363 | nuclear matrix | cell_component | IEA |
GO:0016605 | PML body | cell_component | IEA |
GO:0005669 | transcription factor TFIID complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000008126
- Expression info from Arrayexpress [?] : ENSECAG00000008126
- Protein expression from Protein Atlas: [?] ENSECAG00000008126
- Community gene edition from Wikigenes: [?] 100062044
- entrezgene: 100062044
Click on [?] for more information.