ENSECAG00000002762 (Equus caballus)
Description [+]
- Synonyms:
- Species: Equus caballus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 160 |
PFAM A | AhpC-TSA | 8 | 142 |
PFAM A | 1-cysPrx_C | 152 | 195 |
Protein sequence [+]
| Equus caballus | 9796 | length:199
MSSGNAKIGHPAPNFKATALMPDGQFKDINLADYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASIDSRFCHLAWIKTPKKQGGLRPMNIPLVSDPKCTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQISVNDLPVGHSVDETLRLIQASQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFLKQK
DRAEEFKKLNCQVIGASIDSRFCHLAWIKTPKKQGGLRPMNIPLVSDPKCTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQISVNDLPVGHSVDETLRLIQASQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFLKQK
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000002762
- Expression info from Arrayexpress [?] : ENSECAG00000002762
- Protein expression from Protein Atlas: [?] ENSECAG00000002762
- Community gene edition from Wikigenes: [?] 100071709
- entrezgene: 100071709
Click on [?] for more information.