FAS (Danio rerio)
Description [+]
- Synonyms: FAS, FAS LIGAND (TNF SUPERFAMILY, MEMBER 6), FAS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: Fas (TNF receptor superfamily, member 6) [Source:RefSeq_peptide;Acc:XP_690447]
- Family: Death receptor
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment: Ectopic expression of Fas in zebrafish embryos and human cell lines induces apoptosis [16888647].
- Human ortholog(s): FAS
- WIKI: FAS-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- References from Human ortholog(s):
- The polypeptide encoded by the cDNA for human cell surface antigen Fas can mediate apoptosis.
- Itoh N, Yonehara S, Ishii A, Yonehara M, Mizushima S, Sameshima M, Hase A, Seto Y, Nagata S
- Mouse anti-Fas monoclonal antibody has a cytolytic activity on human cells that express the antigen. Complementary DNAs encoding the cell surface antigen Fas were isolated from a cDNA library of human T cell lymphoma KT-3 cells. The nucleotide sequence of the cDNAs revealed that the molecule coding for the Fas antigen determinant is a 319 amino acid polypeptide (Mr 36,000) with a single transmembrane domain. The extracellular domain is rich in cysteine residue, and shows a similarity to that of human tumor necrosis factor receptors, human nerve growth factor receptor, and human B cell antigen CD40. Murine WR19L cells or L929 cells transformed with the human Fas antigen cDNA were killed by the anti-Fas antibody in the process known as apoptosis. Cell. 1991 Jul 26;66(2):233-43.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNFR_c6 | 52 | 93 |
| PFAM A | Death | 191 | 274 |
Protein sequence [+]
fas | Danio rerio | 7955 | length:280
MPTLTYSWRLRRDASCEFGTYQHERNTCCLCPAGFKVSTHCTNTDKTECKQCEDGYYLNN
NNNENQCRPCKICDANAKMKEIEKCSKSSNTVCGCEEGRFCDKDKDCNVCYPCDPCPNGV
KEQCTETHNTVCHDAKDLTGTIAAVLVPLILIAVLAFMIFIWKKKKFCFQVRPSTDKVQT
EEALPLIDLSPHLPKIADVLCWKTVKEVARRSGMTAKDIEEQEMNHPKDVREQTFGLLEA
WSQRQGLDKAYRALITTLQDIGEKATADKIRNIVEASSQP
NNNENQCRPCKICDANAKMKEIEKCSKSSNTVCGCEEGRFCDKDKDCNVCYPCDPCPNGV
KEQCTETHNTVCHDAKDLTGTIAAVLVPLILIAVLAFMIFIWKKKKFCFQVRPSTDKVQT
EEALPLIDLSPHLPKIADVLCWKTVKEVARRSGMTAKDIEEQEMNHPKDVREQTFGLLEA
WSQRQGLDKAYRALITTLQDIGEKATADKIRNIVEASSQP
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| Q9DGH7_CHICK | orthology | Chicken |
| FAS | orthology | Chimpanzee |
| TNR6_BOVIN | orthology | Cow |
| FAS | orthology | Dog |
| Q90XY4_FUGRU | orthology | Fugu |
| FAS | orthology | Horse |
| FAS | orthology | Human |
| TNR6_MACMU | orthology | Macaca |
| Q56VC6_ORYLA | orthology | Medaka |
| Fas | orthology | Mouse |
| FAS | orthology | Orangutan |
| Fas | orthology | Rat |
| T_nigroviridis_ENSTNIP00000001175 | orthology | Tetraodon |
| T_guttata_ENSTGUP00000017300 | orthology | Zebra finch |
| T_guttata_ENSTGUP00000008561 | orthology | Zebra finch |
| NP_001028813.1 | paralogy | Chicken |
| NP_989996.1 | paralogy | Chicken |
| TNFRSF11A | paralogy | Chicken |
| TNFRSF21 | paralogy | Chicken |
| NM_204115.1 | paralogy | Chicken |
| NP_989717.1 | paralogy | Chicken |
| NP_001025950.1 | paralogy | Chicken |
| TNFRSF10C | paralogy | Chimpanzee |
| LTBR | paralogy | Chimpanzee |
| TNFRSF14 | paralogy | Chimpanzee |
| TNFRSF1B | paralogy | Chimpanzee |
| TNFRSF11B | paralogy | Chimpanzee |
| TNFRSF21 | paralogy | Chimpanzee |
| TNFRSF1A | paralogy | Chimpanzee |
| NP_001096698.1 | paralogy | Cow |
| A6QQC2_BOVIN | paralogy | Cow |
| NP_001091525.1 | paralogy | Cow |
| IPI00699053.2 | paralogy | Cow |
| TNR5_BOVIN | paralogy | Cow |
| TNR1A_BOVIN | paralogy | Cow |
| NP_001092513.1 | paralogy | Cow |
| TNFRSF14 | paralogy | Dog |
| C_familiaris_ENSCAFP00000003059 | paralogy | Dog |
| TNR5_CANFA | paralogy | Dog |
| TNFRSF11B | paralogy | Dog |
| O97530_CANFA | paralogy | Dog |
| TNFRSF1B | paralogy | Dog |
| C_familiaris_ENSCAFP00000032150 | paralogy | Dog |
| LTBR | paralogy | Dog |
| TNFRSF4 | paralogy | Dog |
| T_rubripes_ENSTRUP00000013812 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000010129 | paralogy | Fugu |
| TNFRSF21 | paralogy | Fugu |
| TNFRSF1B | paralogy | Fugu |
| LTBR | paralogy | Fugu |
| T_rubripes_ENSTRUP00000011041 | paralogy | Fugu |
| TNFRSF25 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000035238 | paralogy | Fugu |
| TNFRSF14 | paralogy | Gasterosteus |
| LTBR | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000007142 | paralogy | Gasterosteus |
| TNFRSF1B | paralogy | Gasterosteus |
| TNFRSF25 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000011439 | paralogy | Gasterosteus |
| NGFR (1 of 2) | paralogy | Gasterosteus |
| TNFRSF21 | paralogy | Gasterosteus |
| LTBR | paralogy | Gorilla |
| CD40 | paralogy | Gorilla |
| TNFRSF1A | paralogy | Gorilla |
| TNFRSF21 | paralogy | Gorilla |
| TNFRSF21 | paralogy | Horse |
| TNFRSF4 | paralogy | Horse |
| TNFRSF1A | paralogy | Horse |
| NP_001075376.1 | paralogy | Horse |
| TNFRSF11B | paralogy | Horse |
| LTBR | paralogy | Horse |
| TNFRSF1B | paralogy | Horse |
| TNR5_HORSE | paralogy | Horse |
| TNFRSF1B | paralogy | Human |
| LTBR | paralogy | Human |
| TNFRSF11B | paralogy | Human |
| TNFRSF1A | paralogy | Human |
| CD40 | paralogy | Human |
| TNFRSF21 | paralogy | Human |
| TNFRSF14 | paralogy | Human |
| TNFRSF11B | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000011266 | paralogy | Lyzard |
| TNFRSF11A | paralogy | Lyzard |
| TNFRSF14 | paralogy | Macaca |
| TNFRSF1A | paralogy | Macaca |
| TNFRSF11B | paralogy | Macaca |
| TNFRSF21 | paralogy | Macaca |
| CD40 | paralogy | Macaca |
| TNFRSF1B | paralogy | Macaca |
| LTBR | paralogy | Macaca |
| TNFRSF1B | paralogy | Medaka |
| O_latipes_ENSORLP00000020293 | paralogy | Medaka |
| TNFRSF21 | paralogy | Medaka |
| O_latipes_ENSORLP00000000867 | paralogy | Medaka |
| O_latipes_ENSORLP00000003602 | paralogy | Medaka |
| TNFRSF14 | paralogy | Medaka |
| TNFRSF25 | paralogy | Medaka |
| CD40 | paralogy | Monodelphis |
| TNFRSF11B | paralogy | Monodelphis |
| LTBR | paralogy | Monodelphis |
| TNFRSF1A | paralogy | Monodelphis |
| TNFRSF21 | paralogy | Monodelphis |
| Tnfrsf1a | paralogy | Mouse |
| Cd40 | paralogy | Mouse |
| Tnfrsf22 | paralogy | Mouse |
| Tnfrsf10b | paralogy | Mouse |
| Tnfrsf14 | paralogy | Mouse |
| Tnfrsf4 | paralogy | Mouse |
| M_musculus_ENSMUSP00000078705 | paralogy | Mouse |
| Tnfrsf23 | paralogy | Mouse |
| Tnfrsf26 | paralogy | Mouse |
| TNFRSF1B | paralogy | Orangutan |
| TNFRSF11B | paralogy | Orangutan |
| TNFRSF1A | paralogy | Orangutan |
| TNFRSF25 | paralogy | Ornithorhynchus |
| TNFRSF21 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000007822 | paralogy | Ornithorhynchus |
| TNFRSF11B | paralogy | Rabbit |
| CD40 | paralogy | Rabbit |
| TNFRSF21 | paralogy | Rabbit |
| LTBR | paralogy | Rabbit |
| Tnfrsf1a | paralogy | Rat |
| R_norvegicus_ENSRNOP00000051744 | paralogy | Rat |
| Tnfrsf14 | paralogy | Rat |
| Tnfrsf5 | paralogy | Rat |
| Tnfrsf4 | paralogy | Rat |
| TNFRSF1B | paralogy | Tetraodon |
| LTBR | paralogy | Tetraodon |
| NGFR (2 of 2) | paralogy | Tetraodon |
| TNFRSF10D | paralogy | Tetraodon |
| BC089228.1 | paralogy | Xenopus |
| nrh1a | paralogy | Xenopus |
| TNFRSF21 | paralogy | Xenopus |
| NGFR | paralogy | Xenopus |
| BC075302.1 | paralogy | Xenopus |
| TNFRSF21 | paralogy | Zebra finch |
| TNFRSF1A | paralogy | Zebra finch |
| TNFRSF11B | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000002526 | paralogy | Zebra finch |
| zgc:153631 | paralogy | Zebrafish |
| hdr | paralogy | Zebrafish |
| Q6NW61_DANRE | paralogy | Zebrafish |
| LTBR | paralogy | Zebrafish |
| tnfrsf21 | paralogy | Zebrafish |
| zgc:158862 | paralogy | Zebrafish |
| D_rerio_ENSDARP00000049844 | paralogy | Zebrafish |
| zgc:153631 | paralogy | Zebrafish |
| LOC797761 | paralogy | Zebrafish |
| tnfrsfa | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IDA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0004872 | receptor activity | mollecular_function | IEA |
| GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-061019-2
- Ensembl genome browser [?] : ENSDARG00000043586
- Expression info from Arrayexpress [?] : ENSDARG00000043586
- Protein expression from Protein Atlas: [?] ENSDARG00000043586
- Community gene edition from Wikigenes: [?] 768248
- entrezgene: 768248
Click on [?] for more information.
