ZGC:91930 (Danio rerio)
Description [+]
- Synonyms: ZGC:91930
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: hypothetical protein LOC445486 [Source:RefSeq_peptide;Acc:NP_001003993]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: ZGC:91930-D_rerio
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 13 | 169 |
Protein sequence [+]
zgc:91930 | Danio rerio | 7955 | length:194
MADKIKNAKIVFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEVASGSERGKQLQAI
MQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALLLYIDA
KGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVD
EVFAIVEKAIDELK
MQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALLLYIDA
KGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVD
EVFAIVEKAIDELK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0046034 | ATP metabolic process | biological_proccess | IEA |
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0017111 | nucleoside-triphosphatase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-040822-37
- Ensembl genome browser [?] : ENSDARG00000001950
- Expression info from Arrayexpress [?] : ENSDARG00000001950
- Protein expression from Protein Atlas: [?] ENSDARG00000001950
- Community gene edition from Wikigenes: [?] 445486
- entrezgene: 445486
- refseq_dna: NM_001003993
- refseq_peptide: NP_001003993
Click on [?] for more information.