TRAF1 (Drosophila melanogaster)
Description [+]
- Synonyms: TRAF1, TNF-RECEPTOR-ASSOCIATED FACTOR 4, TRAF4
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: other
- Process: cell death (other),
- Pathways: TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): TRAF4
- WIKI: TRAF1-D_melanogaster
References [+]
- The Drosophila tumor necrosis factor receptor-associated factor-1 (DTRAF1) interacts with Pelle and regulates NFkappaB activity.
- Zapata JM, Matsuzawa S, Godzik A, Leo E, Wasserman SA, Reed JC
- A member of the tumor necrosis factor (TNF) receptor-associated factor (TRAF) family was identified in Drosophila. DTRAF1 contains 7 zinc finger domains followed by a TRAF domain, similar to mammalian TRAFs and other members of the family identified in data bases from Caenorhabditis elegans, Arabidopsis, and Dictyostelium. Analysis of DTRAF1 binding to different members of the human TNF receptor family showed that this protein can interact through its TRAF domain with the p75 neurotrophin receptor and weakly with the lymphotoxin-beta receptor. DTRAF1 can also self-associate and binds to human TRAF1, TRAF2, and TRAF4. Interestingly, DTRAF1 interacts with human cIAP-1 and cIAP-2 but not with Drosophila DIAP-1 and -2. By itself, DTRAF1 did not induce significant NFkappaB activation when overexpressed in mammalian cells, although it specifically increased NFkappaB induction by TRAF6. In contrast, TRAF2-mediated NFkappaB induction was partially inhibited by DTRAF1. Mutants of DTRAF1 lacking the N-terminal region inhibited NFkappaB induction by either TRAF2 or TRAF6. DTRAF1 specifically associated with the regulatory N-terminal domain of Pelle, a Drosophila homolog of the human kinase interleukin-1 receptor-associated kinase (IRAK). Interestingly, though Pelle and DTRAF1 individually were unable to induce NFkappaB in a human cell line, co-expression of Pelle and DTRAF1 resulted in significant NFkappaB activity. Interactions of DTRAF1 with human TRAF-, TNF receptor-, and IAP-family proteins imply strong evolutionary conservation of TRAF protein structure and function throughout Metazoan evolution. J Biol Chem. 2000 Apr 21;275(16):12102-7.
- Reaper-mediated inhibition of DIAP1-induced DTRAF1 degradation results in activation of JNK in Drosophila.
- Kuranaga E, Kanuka H, Igaki T, Sawamoto K, Ichijo H, Okano H, Miura M
- Although Jun amino-terminal kinase (JNK) is known to mediate a physiological stress signal that leads to cell death, the exact role of the JNK pathway in the mechanisms underlying intrinsic cell death is largely unknown. Here we show through a genetic screen that a mutant of Drosophila melanogaster tumour-necrosis factor receptor-associated factor 1 (DTRAF1) is a dominant suppressor of Reaper-induced cell death. We show that Reaper modulates the JNK pathway through Drosophila inhibitor-of-apoptosis protein 1 (DIAP1), which negatively regulates DTRAF1 by proteasome-mediated degradation. Reduction of JNK signals rescues the Reaper-induced small eye phenotype, and overexpression of DTRAF1 activates the Drosophila ASK1 (apoptosis signal-regulating kinase 1; a mitogen-activated protein kinase kinase kinase) and JNK pathway, thereby inducing cell death. Overexpresson of DIAP1 facilitates degradation of DTRAF1 in a ubiquitin-dependent manner and simultaneously inhibits activation of JNK. Expression of Reaper leads to a loss of DIAP1 inhibition of DTRAF1-mediated JNK activation in Drosophila cells. Taken together, our results indicate that DIAP1 may modulate cell death by regulating JNK activation through a ubiquitin#150;proteasome pathway. Nat Cell Biol. 2002 Sep;4(9):705-10.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | zf-TRAF | 198 | 252 |
PFAM A | zf-TRAF | 306 | 365 |
PFAM A | MATH | 410 | 553 |
Protein sequence [+]
Traf1 | Drosophila melanogaster | 7227 | length:559
MPAPPATVKPATGHTTKLNNGKSSNSNSNHTLSNSIAHLSDSRTNLTVNTPTTCQRLSEM
FRRSIASSTQSSSRENTYEEWTKTLSFPSRLSPNRNSKDCSTLASPVPPPTPPRNKTTSG
SGNCATSRSSSSTVSSSHSSSHSSPTPGNNNNNMPITELEQIIYPGPDPKHIMGSLVFCI
HHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFC
QSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSA
DTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQ
MLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEA
RGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH
SITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFI
KGDTVFLRVKVDPSKIVAV
FRRSIASSTQSSSRENTYEEWTKTLSFPSRLSPNRNSKDCSTLASPVPPPTPPRNKTTSG
SGNCATSRSSSSTVSSSHSSSHSSPTPGNNNNNMPITELEQIIYPGPDPKHIMGSLVFCI
HHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFC
QSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSA
DTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQ
MLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEA
RGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH
SITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFI
KGDTVFLRVKVDPSKIVAV
Structure links:
- Smartdomain prediction information: SM00061
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL006649-PA | orthology | Aedes |
A_gambiae_AGAP010017-PA | orthology | Anopheles |
TRAF4 | orthology | Chimpanzee |
C_intestinalis_ENSCINP00000008928 | orthology | Ciona |
NP_001094750.1 | orthology | Cow |
LOC783305 | orthology | Cow |
TRAF4 | orthology | Dog |
TRAF4 | orthology | Fugu |
TRAF4 | orthology | Gasterosteus |
TRAF4 | orthology | Gorilla |
TRAF4 | orthology | Horse |
TRAF4 | orthology | Human |
TRAF4 | orthology | Macaca |
M_mulatta_ENSMMUP00000022296 | orthology | Macaca |
TRAF4 | orthology | Medaka |
TRAF4 | orthology | Monodelphis |
Traf4 | orthology | Mouse |
TRAF4 | orthology | Orangutan |
TRAF4 | orthology | Ornithorhynchus |
TRAF4 | orthology | Rabbit |
NP_001100487.1 | orthology | Rat |
TRAF4 | orthology | Tetraodon |
traf4 | orthology | Xenopus |
traf4b | orthology | Zebrafish |
traf4a | orthology | Zebrafish |
A_gambiae_AGAP003004-PA | paralogy | Anopheles |
NP_989550.1 | paralogy | Chicken |
TRAF2 | paralogy | Chicken |
TRAF6 | paralogy | Chicken |
TRAF3 | paralogy | Chicken |
TRAF1 | paralogy | Chicken |
TRAF5 | paralogy | Chimpanzee |
TRAF2 | paralogy | Chimpanzee |
TRAF6 | paralogy | Chimpanzee |
TRAF3 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000003738 | paralogy | Ciona |
C_intestinalis_ENSCINP00000001022 | paralogy | Ciona |
C_intestinalis_ENSCINP00000003143 | paralogy | Ciona |
C_intestinalis_ENSCINP00000027890 | paralogy | Ciona |
NP_001029833.1 | paralogy | Cow |
NP_001098810.1 | paralogy | Cow |
TRAF2 | paralogy | Cow |
IPI00716910.2 | paralogy | Cow |
TRAF6 | paralogy | Dog |
TRAF5 | paralogy | Dog |
TRAF3 | paralogy | Dog |
TRAF2 | paralogy | Dog |
TRAF2 (1 of 2) | paralogy | Fugu |
TRAF6 | paralogy | Fugu |
TRAF3 | paralogy | Fugu |
TRAF2 (2 of 2) | paralogy | Fugu |
T_rubripes_ENSTRUP00000047803 | paralogy | Fugu |
TRAF2 (1 of 2) | paralogy | Gasterosteus |
TRAF6 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000022084 | paralogy | Gasterosteus |
TRAF3 | paralogy | Gasterosteus |
TRAF2 (2 of 2) | paralogy | Gasterosteus |
TRAF3 | paralogy | Gorilla |
TRAF3 | paralogy | Horse |
TRAF1 | paralogy | Horse |
TRAF6 | paralogy | Horse |
TRAF2 | paralogy | Horse |
TRAF5 | paralogy | Horse |
TRAF3 | paralogy | Human |
TRAF6 | paralogy | Human |
TRAF5 | paralogy | Human |
TRAF2 | paralogy | Human |
TRAF3 | paralogy | Lyzard |
TRAF5 | paralogy | Lyzard |
TRAF2 | paralogy | Lyzard |
TRAF6 | paralogy | Lyzard |
TRAF3 | paralogy | Macaca |
TRAF5 | paralogy | Macaca |
M_mulatta_ENSMMUP00000021905 | paralogy | Macaca |
M_mulatta_ENSMMUP00000021907 | paralogy | Macaca |
TRAF2 | paralogy | Macaca |
TRAF2 (2 of 2) | paralogy | Medaka |
TRAF2 (1 of 2) | paralogy | Medaka |
TRAF5 | paralogy | Medaka |
O_latipes_ENSORLP00000008989 | paralogy | Medaka |
TRAF6 | paralogy | Medaka |
TRAF2 | paralogy | Monodelphis |
TRAF1 | paralogy | Monodelphis |
TRAF3 | paralogy | Monodelphis |
TRAF5 | paralogy | Monodelphis |
TRAF6 | paralogy | Monodelphis |
Traf6 | paralogy | Mouse |
Traf2 | paralogy | Mouse |
Traf3 | paralogy | Mouse |
Traf5 | paralogy | Mouse |
TRAF5 | paralogy | Orangutan |
TRAF3 | paralogy | Orangutan |
TRAF6 | paralogy | Orangutan |
TRAF2 | paralogy | Orangutan |
TRAF6 | paralogy | Ornithorhynchus |
TRAF3 | paralogy | Ornithorhynchus |
TRAF5 | paralogy | Ornithorhynchus |
TRAF1 | paralogy | Ornithorhynchus |
TRAF3 | paralogy | Rabbit |
TRAF5 | paralogy | Rabbit |
TRAF6 | paralogy | Rabbit |
Traf2_predicted | paralogy | Rat |
NP_001101224.1 | paralogy | Rat |
Traf3_predicted | paralogy | Rat |
TRAF3 | paralogy | Tetraodon |
TRAF2 (1 of 2) | paralogy | Tetraodon |
TRAF2 (2 of 2) | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000011878 | paralogy | Tetraodon |
TRAF6 | paralogy | Tetraodon |
Y110A7A.2 | paralogy | Worm |
trf-1 | paralogy | Worm |
TRAF2 | paralogy | Xenopus |
TRAF5 | paralogy | Xenopus |
traf6 | paralogy | Xenopus |
TRAF3 | paralogy | Xenopus |
TRAF2 | paralogy | Zebra finch |
TRAF6 | paralogy | Zebra finch |
TRAF5 | paralogy | Zebra finch |
TRAF3 | paralogy | Zebra finch |
TRAF1 | paralogy | Zebra finch |
si:dkey-170o10.1 | paralogy | Zebrafish |
TRAF1 | paralogy | Zebrafish |
traf6 | paralogy | Zebrafish |
TRAF5 (2 of 2) | paralogy | Zebrafish |
zgc:92367 | paralogy | Zebrafish |
TRAF2 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006810 | transport | biological_proccess | IEA |
GO:0006811 | ion transport | biological_proccess | IEA |
GO:0006814 | sodium ion transport | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005216 | ion channel activity | mollecular_function | IEA |
GO:0005272 | sodium channel activity | mollecular_function | IEA |
GO:0031402 | sodium ion binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0026319
- Ensembl genome browser [?] : FBgn0026319
- Expression info from Arrayexpress [?] : FBgn0026319
- Protein expression from Protein Atlas: [?] FBgn0026319
Click on [?] for more information.