BSK (Drosophila melanogaster)
Description [+]
- Synonyms: BSK, JNK, STRESS-ACTIVATED PROTEIN KINASE JNK
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: other
- Process: cell death (other),
- Pathways:
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): MAPK8 MAPK10 MAPK9
- WIKI: BSK-D_melanogaster
References [+]
- A JNK signal transduction pathway that mediates morphogenesis and an immune response in Drosophila.
- Sluss HK, Han Z, Barrett T, Goberdhan DC, Wilson C, Davis RJ, Ip YT
- The Drosophila MAP kinase DJNK is a homolog of the mammalian c-Jun amino-terminal kinase (JNK). Mutations in the DJNK gene correspond to the complementation group basket. DJNK is phosphorylated and activated by the Drosophila MAP kinase kinase HEP. Substrates of DJNK include the transcription factor DJun. DJNK participates in multiple physiological processes. Exposure to endotoxic lipopolysaccharide initiates an insect immune response and leads to DJNK activation. In addition, embryos lacking DJNK are defective in dorsal closure, a process in which the lateral epithelial cells migrate over the embryo and join at the dorsal midline. These data demonstrate that the DJNK signal transduction pathway mediates an immune response and morphogenesis in vivo. Genes Dev. 1996 Nov 1;10(21):2745-58.
- Distortion of proximodistal information causes JNK-dependent apoptosis in Drosophila wing.
- Adachi-Yamada T, Fujimura-Kamada K, Nishida Y, Matsumoto K
- Distinct and evolutionarily conserved signal-transduction cascades mediate the survival or death of cells during development. The c-Jun amino-terminal kinases (JNKs) of the mitogen-activated protein kinase superfamily are involved in apoptotic signalling in various cultured cells. However, the role of the JNK pathway in development is less well understood. In Drosophila, Decapentaplegic (Dpp; a homologue of transforming growth factor-beta) and Wingless (Wg; a Wnt homologue) proteins are secretory morphogens that act cooperatively to induce formation of the proximodistal axis of appendages. Here we show that either decreased Dpp signalling in the distal wing cells or increased Dpp signalling in the proximal wing cells causes apoptosis. Inappropriate levels of Dpp signalling lead to aberrant morphogenesis in the respective wing zones, and these apoptotic zones are also determined by the strength of the Wg signal. Our results indicate that distortion of the positional information determined by Dpp and Wg signalling gradients leads to activation of the JNK apoptotic pathway, and the consequent induction of cell death thereby maintains normal morphogenesis. Nature. 1999 Jul 8;400(6740):166-9.
- References from Human ortholog(s):
- JNK1: a protein kinase stimulated by UV light and Ha-Ras that binds and phosphorylates the c-Jun activation domain.
- Derijard B, Hibi M, Wu IH, Barrett T, Su B, Deng T, Karin M, Davis RJ
- The ultraviolet (UV) response of mammalian cells is characterized by a rapid and selective increase in gene expression mediated by AP-1 and NF-kappa B. The effect on AP-1 transcriptional activity results, in part, from enhanced phosphorylation of the c-Jun NH2-terminal activation domain. Here, we describe the molecular cloning and characterization of JNK1, a distant relative of the MAP kinase group that is activated by dual phosphorylation at Thr and Tyr during the UV response. Significantly, Ha-Ras partially activates JNK1 and potentiates the activation caused by UV. JNK1 binds to the c-Jun transactivation domain and phosphorylates it on Ser-63 and Ser-73. Thus, JNK1 is a component of a novel signal transduction pathway that is activated by oncoproteins and UV irradiation. These properties indicate that JNK1 activation may play an important role in tumor promotion. Cell. 1994 Mar 25;76(6):1025-37.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 24 | 320 |
PFAM A | Pkinase_Tyr | 24 | 320 |
Protein sequence [+]
bsk | Drosophila melanogaster | 7227 | length:372
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL008634-PA | orthology | Aedes |
A_gambiae_AGAP009461-PA | orthology | Anopheles |
MAPK10 | orthology | Chicken |
MK09_CHICK | orthology | Chicken |
MAPK8 | orthology | Chicken |
MAPK10 | orthology | Chimpanzee |
MAPK8 | orthology | Chimpanzee |
MAPK9 | orthology | Chimpanzee |
Q4H3A2_CIOIN | orthology | Ciona |
NM_001083728.1 | orthology | Cow |
NP_001077197.1 | orthology | Cow |
NP_001039834.1 | orthology | Cow |
MAPK9 | orthology | Dog |
MAPK8 | orthology | Dog |
MAPK10 | orthology | Dog |
MAPK9 | orthology | Fugu |
MAPK8 (1 of 2) | orthology | Fugu |
MAPK8 (2 of 2) | orthology | Fugu |
MAPK10 | orthology | Fugu |
MAPK10 | orthology | Gasterosteus |
MAPK8 (1 of 2) | orthology | Gasterosteus |
MAPK9 | orthology | Gasterosteus |
MAPK8 (2 of 2) | orthology | Gasterosteus |
MAPK9 | orthology | Gorilla |
MAPK9 | orthology | Horse |
MAPK8 | orthology | Horse |
MAPK10 | orthology | Horse |
MAPK8 | orthology | Human |
MAPK10 | orthology | Human |
MAPK9 | orthology | Human |
MAPK9 | orthology | Lyzard |
MAPK8 | orthology | Lyzard |
MAPK10 | orthology | Lyzard |
MAPK8 | orthology | Macaca |
MAPK10 | orthology | Macaca |
MAPK9 | orthology | Macaca |
MAPK8 (2 of 2) | orthology | Medaka |
MAPK8 (1 of 2) | orthology | Medaka |
MAPK10 | orthology | Medaka |
MAPK9 | orthology | Medaka |
MAPK10 | orthology | Monodelphis |
MAPK8 | orthology | Monodelphis |
MAPK9 | orthology | Monodelphis |
Mapk8 | orthology | Mouse |
Mapk9 | orthology | Mouse |
Mapk10 | orthology | Mouse |
MAPK8 | orthology | Orangutan |
MAPK9 | orthology | Orangutan |
Q5RA26_PONPY | orthology | Orangutan |
MAPK10 | orthology | Ornithorhynchus |
MAPK9 | orthology | Ornithorhynchus |
MAPK8 | orthology | Ornithorhynchus |
MAPK10 | orthology | Rabbit |
MAPK9 | orthology | Rabbit |
MAPK8 | orthology | Rabbit |
Mapk9 | orthology | Rat |
Mapk10 | orthology | Rat |
Mapk8 | orthology | Rat |
MAPK8 (1 of 2) | orthology | Tetraodon |
MAPK9 | orthology | Tetraodon |
MAPK10 | orthology | Tetraodon |
MAPK8 (2 of 2) | orthology | Tetraodon |
jnk-1 | orthology | Worm |
MAPK8 | orthology | Xenopus |
MAPK10 | orthology | Xenopus |
MAPK10 | orthology | Zebra finch |
MAPK9 | orthology | Zebra finch |
MAPK8 | orthology | Zebra finch |
zgc:123234 | orthology | Zebrafish |
MAPK8 (2 of 2) | orthology | Zebrafish |
mapk8 | orthology | Zebrafish |
A_aegypti_AAEL008622-PA | paralogy | Aedes |
Q1L0R1_AEDAE | paralogy | Aedes |
A_gambiae_AGAP009460-PA | paralogy | Anopheles |
NP_001006227.1 | paralogy | Chicken |
MAPK13 | paralogy | Chicken |
Q5ZLJ0_CHICK | paralogy | Chicken |
MK14_PANTR | paralogy | Chimpanzee |
MK13_PANTR | paralogy | Chimpanzee |
MK13_BOVIN | paralogy | Cow |
NP_001092423.1 | paralogy | Cow |
NP_001095644.1 | paralogy | Cow |
NP_001073804.1 | paralogy | Cow |
MAPK13 | paralogy | Dog |
MK14_CANFA | paralogy | Dog |
MAPK12 | paralogy | Dog |
p38b | paralogy | Fly |
Mpk2 | paralogy | Fly |
MAPK11 | paralogy | Fugu |
T_rubripes_ENSTRUP00000021906 | paralogy | Fugu |
MAPK13 | paralogy | Fugu |
T_rubripes_ENSTRUP00000041575 | paralogy | Fugu |
MAPK13 | paralogy | Gasterosteus |
MAPK11 | paralogy | Gasterosteus |
MAPK12 (1 of 2) | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000010808 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000010206 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000004959 | paralogy | Gasterosteus |
MAPK14 | paralogy | Horse |
MAPK11 | paralogy | Horse |
MAPK14 | paralogy | Human |
MAPK11 | paralogy | Human |
MAPK12 | paralogy | Human |
MAPK13 | paralogy | Human |
MAPK14 | paralogy | Lyzard |
MAPK11 | paralogy | Lyzard |
MAPK13 | paralogy | Lyzard |
MAPK14 | paralogy | Macaca |
MAPK11 | paralogy | Macaca |
MAPK12 | paralogy | Macaca |
O_latipes_ENSORLP00000008135 | paralogy | Medaka |
MAPK12 (1 of 2) | paralogy | Medaka |
MAPK12 (2 of 2) | paralogy | Medaka |
MAPK13 | paralogy | Medaka |
MAPK14 | paralogy | Monodelphis |
MAPK11 | paralogy | Monodelphis |
MAPK13 | paralogy | Monodelphis |
MAPK12 | paralogy | Monodelphis |
Mapk13 | paralogy | Mouse |
Mapk11 | paralogy | Mouse |
Mapk14 | paralogy | Mouse |
Mapk12 | paralogy | Mouse |
MAPK13 | paralogy | Orangutan |
MAPK14 | paralogy | Orangutan |
MAPK13 | paralogy | Ornithorhynchus |
Mapk13 | paralogy | Rat |
LOC679007 | paralogy | Rat |
Mapk14 | paralogy | Rat |
Mapk12 | paralogy | Rat |
MAPK11 | paralogy | Tetraodon |
MAPK12 (2 of 3) | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000018173 | paralogy | Tetraodon |
MAPK13 (1 of 2) | paralogy | Tetraodon |
MAPK12 (1 of 3) | paralogy | Tetraodon |
MAPK12 (3 of 3) | paralogy | Tetraodon |
pmk-1 | paralogy | Worm |
kgb-1 | paralogy | Worm |
kgb-2 | paralogy | Worm |
MAPK11 | paralogy | Xenopus |
mapk12 | paralogy | Xenopus |
X_tropicalis_ENSXETP00000000876 | paralogy | Xenopus |
MAPK11 | paralogy | Zebra finch |
T_guttata_ENSTGUP00000001679 | paralogy | Zebra finch |
MAPK14 | paralogy | Zebra finch |
zgc:86905 | paralogy | Zebrafish |
mapk14b | paralogy | Zebrafish |
LOC797284 | paralogy | Zebrafish |
mapk12 | paralogy | Zebrafish |
LOC100002318 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008168 | methyltransferase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0000229
- Ensembl genome browser [?] : FBgn0000229
- Expression info from Arrayexpress [?] : FBgn0000229
- Protein expression from Protein Atlas: [?] FBgn0000229
Click on [?] for more information.