ATG8A (Drosophila melanogaster)
Description [+]
- Synonyms: ATG8A
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: Autophagy-specific gene 8a
- Family: other
- Process: cell death (other),
- Pathways:
- Criteria: manually curated
- Curator comment: This protein participates in autophagic cell death during Drosophila development.
- Human ortholog(s): GABARAP
- WIKI: ATG8A-D_melanogaster
References [+]
- Growth arrest and autophagy are required for salivary gland cell degradation in Drosophila.
- Berry DL, Baehrecke EH
- Autophagy is a catabolic process that is negatively regulated by growth and has been implicated in cell death. We find that autophagy is induced following growth arrest and precedes developmental autophagic cell death of Drosophila salivary glands. Maintaining growth by expression of either activated Ras or positive regulators of the class I phosphoinositide 3-kinase (PI3K) pathway inhibits autophagy and blocks salivary gland cell degradation. Developmental degradation of salivary glands is also inhibited in autophagy gene (atg) mutants. Caspases are active in PI3K-expressing and atg mutant salivary glands, and combined inhibition of both autophagy and caspases increases suppression of gland degradation. Further, induction of autophagy is sufficient to induce premature cell death in a caspase-independent manner. Our results provide in vivo evidence that growth arrest, autophagy, and atg genes are required for physiological autophagic cell death and that multiple degradation pathways cooperate in the efficient clearance of cells during development. Cell. 2007 Dec 14;131(6):1137-48.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | MAP1_LC3 | 13 | 116 |
Protein sequence [+]
Atg8a | Drosophila melanogaster | 7227 | length:121
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGMAKI
N
YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGMAKI
N
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL007162-PA | orthology | Aedes |
A_gambiae_AGAP002685-PA | orthology | Anopheles |
GABARAP | orthology | Chimpanzee |
NA | orthology | Ciona |
GBRAP_BOVIN | orthology | Cow |
GABARAP | orthology | Dog |
GABARAP | orthology | Fugu |
GABARAP | orthology | Gasterosteus |
GABARAP | orthology | Gorilla |
GABARAP | orthology | Human |
XM_001086014.1 | orthology | Macaca |
GABARAP | orthology | Macaca |
GABARAP | orthology | Macaca |
GABARAP | orthology | Medaka |
GABARAP | orthology | Monodelphis |
Gabarap | orthology | Mouse |
GABARAP | orthology | Orangutan |
O_cuniculus_ENSOCUP00000006049 | orthology | Rabbit |
GBRAP_RABIT | orthology | Rabbit |
GBRAP_RAT | orthology | Rat |
lgg-1 | orthology | Worm |
ATG8 | orthology | Yeast |
gabarap | orthology | Zebrafish |
LOC793200 | orthology | Zebrafish |
IPI00582136.2 | paralogy | Chicken |
IPI00601928.2 | paralogy | Chicken |
NP_001026632.1 | paralogy | Chicken |
IPI00582033.3 | paralogy | Chicken |
IPI00588023.2 | paralogy | Chicken |
XR_023844.1 | paralogy | Chimpanzee |
MAP1LC3C | paralogy | Chimpanzee |
GABARAPL3 | paralogy | Chimpanzee |
GABARAPL2 | paralogy | Chimpanzee |
MAP1LC3A | paralogy | Chimpanzee |
XR_023874.1 | paralogy | Chimpanzee |
NA | paralogy | Ciona |
NM_001033616.1 | paralogy | Cow |
NP_001094528.1 | paralogy | Cow |
MLP3B_BOVIN | paralogy | Cow |
MLP3A_BOVIN | paralogy | Cow |
GBRL2_BOVIN | paralogy | Cow |
C_familiaris_ENSCAFP00000029489 | paralogy | Dog |
MAP1LC3A | paralogy | Dog |
GABARAPL2 | paralogy | Dog |
MAP1LC3C | paralogy | Dog |
C_familiaris_ENSCAFP00000019851 | paralogy | Dog |
D_melanogaster_FBpp0082957 | paralogy | Fly |
GABARAPL2 | paralogy | Fugu |
MAP1LC3B | paralogy | Fugu |
T_rubripes_ENSTRUP00000006597 | paralogy | Fugu |
MAP1LC3C | paralogy | Fugu |
GABARAPL3 | paralogy | Fugu |
MAP1LC3A | paralogy | Fugu |
T_rubripes_ENSTRUP00000037423 | paralogy | Fugu |
MAP1LC3A | paralogy | Gasterosteus |
GABARAPL2 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000023281 | paralogy | Gasterosteus |
GABARAPL3 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000002806 | paralogy | Gasterosteus |
MAP1LC3C | paralogy | Gasterosteus |
MAP1LC3B | paralogy | Gasterosteus |
MAP1LC3C | paralogy | Gorilla |
GABARAPL3 | paralogy | Gorilla |
GABARAPL2 | paralogy | Gorilla |
E_caballus_ENSECAP00000003565 | paralogy | Horse |
GABARAPL2 | paralogy | Horse |
MAP1LC3A | paralogy | Horse |
XP_001493663.1 | paralogy | Horse |
E_caballus_ENSECAP00000012485 | paralogy | Horse |
E_caballus_ENSECAP00000007864 | paralogy | Horse |
MAP1LC3B2 | paralogy | Human |
MAP1LC3C | paralogy | Human |
MAP1LC3B | paralogy | Human |
GABARAPL2 | paralogy | Human |
GABARAPL3 | paralogy | Human |
MAP1LC3A | paralogy | Human |
A_carolinensis_ENSACAP00000014328 | paralogy | Lyzard |
MAP1LC3A | paralogy | Lyzard |
A_carolinensis_ENSACAP00000017290 | paralogy | Lyzard |
GABARAPL2 | paralogy | Lyzard |
A_carolinensis_ENSACAP00000004403 | paralogy | Lyzard |
MAP1LC3C | paralogy | Lyzard |
XM_001093103.1 | paralogy | Macaca |
XM_001104437.1 | paralogy | Macaca |
XM_001105932.1 | paralogy | Macaca |
GABARAPL3 | paralogy | Macaca |
M_mulatta_ENSMMUP00000023179 | paralogy | Macaca |
MAP1LC3A | paralogy | Macaca |
LOC695419 | paralogy | Macaca |
GABARAPL2 | paralogy | Macaca |
O_latipes_ENSORLP00000003491 | paralogy | Medaka |
GABARAPL3 | paralogy | Medaka |
MAP1LC3A | paralogy | Medaka |
GABARAPL2 | paralogy | Medaka |
MAP1LC3C | paralogy | Medaka |
O_latipes_ENSORLP00000018991 | paralogy | Medaka |
M_domestica_ENSMODP00000027793 | paralogy | Monodelphis |
GABARAPL2 | paralogy | Monodelphis |
XM_001372041.1 | paralogy | Monodelphis |
XM_001366038.1 | paralogy | Monodelphis |
MAP1LC3C | paralogy | Monodelphis |
MAP1LC3A | paralogy | Monodelphis |
XM_001363059.1 | paralogy | Monodelphis |
Map1lc3a | paralogy | Mouse |
Gabarapl2 | paralogy | Mouse |
Gabarapl1 | paralogy | Mouse |
Map1lc3b | paralogy | Mouse |
MAP1LC3C | paralogy | Orangutan |
MAP1LC3A | paralogy | Orangutan |
GABARAPL3 | paralogy | Orangutan |
GABARAPL2 | paralogy | Orangutan |
P_pygmaeus_ENSPPYP00000008605 | paralogy | Orangutan |
P_pygmaeus_ENSPPYP00000004869 | paralogy | Orangutan |
GABARAPL2 | paralogy | Ornithorhynchus |
O_anatinus_ENSOANP00000005318 | paralogy | Ornithorhynchus |
O_anatinus_ENSOANP00000005643 | paralogy | Ornithorhynchus |
GABARAPL3 | paralogy | Rabbit |
GABARAPL2 | paralogy | Rabbit |
MLP3A_RAT | paralogy | Rat |
RGD1562165 | paralogy | Rat |
R_norvegicus_ENSRNOP00000019033 | paralogy | Rat |
IPI00781669.1 | paralogy | Rat |
R_norvegicus_ENSRNOP00000043130 | paralogy | Rat |
R_norvegicus_ENSRNOP00000043585 | paralogy | Rat |
GBRL1_RAT | paralogy | Rat |
GBRL2_RAT | paralogy | Rat |
T_nigroviridis_ENSTNIP00000011698 | paralogy | Tetraodon |
GABARAPL2 | paralogy | Tetraodon |
GABARAPL3 | paralogy | Tetraodon |
MAP1LC3C | paralogy | Tetraodon |
MAP1LC3A | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000019905 | paralogy | Tetraodon |
lgg-2 | paralogy | Worm |
map1lc3b | paralogy | Xenopus |
map1lc3c | paralogy | Xenopus |
X_tropicalis_ENSXETP00000013268 | paralogy | Xenopus |
GABARAPL2 | paralogy | Xenopus |
map1lc3a | paralogy | Xenopus |
gabarapl1 | paralogy | Xenopus |
XP_002192995.1 | paralogy | Zebra finch |
GABARAPL2 | paralogy | Zebra finch |
MAP1LC3B | paralogy | Zebra finch |
GABARAPL1 | paralogy | Zebra finch |
MAP1LC3A | paralogy | Zebra finch |
MAP1LC3C | paralogy | Zebra finch |
zgc:56565 | paralogy | Zebrafish |
map1lc3a | paralogy | Zebrafish |
zgc:92606 | paralogy | Zebrafish |
gabarapl2 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Information from other databases [+]
- Ensembl genome browser [?] : FBgn0052672
- Expression info from Arrayexpress [?] : FBgn0052672
- Protein expression from Protein Atlas: [?] FBgn0052672
Click on [?] for more information.