TRAF2 (Drosophila melanogaster)
Description [+]
- Synonyms: TRAF2, TNF-RECEPTOR-ASSOCIATED FACTOR 6, TRAF6
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: other
- Process: cell death (other),
- Pathways: TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): TRAF6
- WIKI: TRAF2-D_melanogaster
References [+]
- Eiger and its receptor, Wengen, comprise a TNF-like system in Drosophila.
- Kauppila S, Maaty WS, Chen P, Tomar RS, Eby MT, Chapo J, Chew S, Rathore N, Zachariah S, Sinha SK, Abrams JM, Chaudhary PM
- In mammals, members of the tumor necrosis factor (TNF) family play an important role in the regulation of cellular proliferation, differentiation and programmed cell death. We describe isolation and characterization of an orthologous ligand/receptor axis in Drosophila. The ligand, designated Eiger, is a type II membrane glycosylated protein, which can be cleaved at residue 145 and released from the cell surface as a soluble factor, thereby representing the first potential cytokine to be described in Drosophila. Eiger exists in two alternatively spliced isoforms, Eiger long (Eiger-L) and Eiger short (Eiger-s), both of which are expressed throughout development and in the adult. We also describe the isolation and characterization of a novel Drosophila member of the TNF receptor family, designated Wengen, which is a type I membrane protein that can physically interact with the recently described TRAF2 homolog dTRAF2. Both Eiger and Wengen are expressed in distinctive patterns during embryogenesis and Eiger is responsive to genotoxic stress. Forced expression of Eiger-L, Eiger-s or Wengen, caused apoptotic cell death which could be rescued by caspase inhibitors or the JNK phosphatase Puckered. In addition, Eiger-induced cell killing was attenuated by RNAi-mediated suppression of Wengen. Our results illustrate that Eiger and Wengen represent proximal components of an evolutionarily conserved TNF-like signaling pathway in Drosophila. Oncogene. 2003 Jul 31;22(31):4860-7.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | zf-C3HC4 | 104 | 142 |
Protein sequence [+]
Traf2 | Drosophila melanogaster | 7227 | length:475
MQRVQADQKPARMHQHAHTHSHAHSLQHAEEKEHNSNEMTTNLSSTGRIAASSSATPSAA
AGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCG
HRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVA
SPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQ
AFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRT
REQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECY
TSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQH
DTIMTKPEILAFHKPREAISTRGFGFLEYANISNIIQLGFCADDRLLIKIEINIV
AGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCG
HRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVA
SPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQ
AFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRT
REQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECY
TSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQH
DTIMTKPEILAFHKPREAISTRGFGFLEYANISNIIQLGFCADDRLLIKIEINIV
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_gambiae_AGAP003004-PA | orthology | Anopheles |
TRAF6 | orthology | Chicken |
TRAF6 | orthology | Chimpanzee |
NP_001029833.1 | orthology | Cow |
TRAF6 | orthology | Dog |
TRAF6 | orthology | Fugu |
TRAF6 | orthology | Gasterosteus |
TRAF6 | orthology | Gorilla |
TRAF6 | orthology | Horse |
TRAF6 | orthology | Human |
TRAF6 | orthology | Lyzard |
M_mulatta_ENSMMUP00000021905 | orthology | Macaca |
M_mulatta_ENSMMUP00000021907 | orthology | Macaca |
TRAF6 | orthology | Medaka |
TRAF6 | orthology | Monodelphis |
Traf6 | orthology | Mouse |
TRAF6 | orthology | Orangutan |
TRAF6 | orthology | Ornithorhynchus |
TRAF6 | orthology | Rabbit |
NP_001101224.1 | orthology | Rat |
TRAF6 | orthology | Tetraodon |
traf6 | orthology | Xenopus |
TRAF6 | orthology | Zebra finch |
traf6 | orthology | Zebrafish |
TRAF1 | paralogy | Chicken |
NP_001012546.1 | paralogy | Chicken |
TRAF2 | paralogy | Chicken |
NP_989550.1 | paralogy | Chicken |
LNX2 | paralogy | Chicken |
TRAF3 | paralogy | Chicken |
TRAF5 | paralogy | Chimpanzee |
TRAF3 | paralogy | Chimpanzee |
TRAF4 | paralogy | Chimpanzee |
TRAF2 | paralogy | Chimpanzee |
XR_024009.1 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000001022 | paralogy | Ciona |
C_intestinalis_ENSCINP00000001432 | paralogy | Ciona |
C_intestinalis_ENSCINP00000003143 | paralogy | Ciona |
C_intestinalis_ENSCINP00000005981 | paralogy | Ciona |
C_intestinalis_ENSCINP00000027890 | paralogy | Ciona |
TRAF2 | paralogy | Cow |
NP_001098810.1 | paralogy | Cow |
LOC783305 | paralogy | Cow |
IPI00716910.2 | paralogy | Cow |
NP_001069352.1 | paralogy | Cow |
TRI17_BOVIN | paralogy | Cow |
NP_001094750.1 | paralogy | Cow |
TRIM11 | paralogy | Dog |
TRAF5 | paralogy | Dog |
TRAF3 | paralogy | Dog |
TRAF2 | paralogy | Dog |
TRAF2 (2 of 2) | paralogy | Fugu |
TRAF4 | paralogy | Fugu |
TRAF3 | paralogy | Fugu |
TRAF2 (1 of 2) | paralogy | Fugu |
T_rubripes_ENSTRUP00000047803 | paralogy | Fugu |
TRAF2 (2 of 2) | paralogy | Gasterosteus |
TRAF4 | paralogy | Gasterosteus |
TRAF2 (1 of 2) | paralogy | Gasterosteus |
TRAF4 | paralogy | Gorilla |
TRAF5 | paralogy | Horse |
TRAF4 | paralogy | Horse |
TRAF2 | paralogy | Horse |
TRAF3 | paralogy | Horse |
TRAF2 | paralogy | Human |
TRAF4 | paralogy | Human |
TRAF5 | paralogy | Human |
TRAF3 | paralogy | Human |
LONRF2 | paralogy | Human |
TRAF3 | paralogy | Lyzard |
TRAF2 | paralogy | Lyzard |
TRAF5 | paralogy | Lyzard |
TRAF3 | paralogy | Macaca |
LONRF2 | paralogy | Macaca |
TRAF4 | paralogy | Macaca |
TRAF5 | paralogy | Macaca |
TRAF2 (1 of 2) | paralogy | Medaka |
TRAF4 | paralogy | Medaka |
O_latipes_ENSORLP00000008989 | paralogy | Medaka |
TRAF2 (2 of 2) | paralogy | Medaka |
RNF125 | paralogy | Monodelphis |
TRAF3 | paralogy | Monodelphis |
TRAF2 | paralogy | Monodelphis |
TRAF4 | paralogy | Monodelphis |
TRAF1 | paralogy | Monodelphis |
TRAF5 | paralogy | Monodelphis |
Traf4 | paralogy | Mouse |
Traf3 | paralogy | Mouse |
Traf5 | paralogy | Mouse |
Trim39 | paralogy | Mouse |
Traf2 | paralogy | Mouse |
TRAF4 | paralogy | Orangutan |
LONRF2 | paralogy | Orangutan |
TRAF2 | paralogy | Orangutan |
TRAF5 | paralogy | Orangutan |
TRAF3 | paralogy | Orangutan |
TRAF1 | paralogy | Ornithorhynchus |
TRAF5 | paralogy | Ornithorhynchus |
TRAF3 | paralogy | Ornithorhynchus |
TRAF4 | paralogy | Rabbit |
Trim39 | paralogy | Rat |
Traf3_predicted | paralogy | Rat |
NP_001100487.1 | paralogy | Rat |
TRAF3 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000011878 | paralogy | Tetraodon |
TRAF2 (2 of 2) | paralogy | Tetraodon |
TRAF2 (1 of 2) | paralogy | Tetraodon |
TRAF4 | paralogy | Tetraodon |
TRAF3 | paralogy | Xenopus |
TRAF5 | paralogy | Xenopus |
TRAF7 | paralogy | Xenopus |
traf4 | paralogy | Xenopus |
TRAF2 | paralogy | Zebra finch |
TRAF5 | paralogy | Zebra finch |
TRAF1 | paralogy | Zebra finch |
LNX2 | paralogy | Zebra finch |
TRAF3 | paralogy | Zebra finch |
TRAF5 (2 of 2) | paralogy | Zebrafish |
TRAF2 | paralogy | Zebrafish |
traf4b | paralogy | Zebrafish |
si:dkey-170o10.1 | paralogy | Zebrafish |
zgc:158391 | paralogy | Zebrafish |
TRAF1 | paralogy | Zebrafish |
traf4a | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Information from other databases [+]
- Gene info from FyBase [?] FBgn0026318
- Ensembl genome browser [?] : FBgn0026318
- Expression info from Arrayexpress [?] : FBgn0026318
- Protein expression from Protein Atlas: [?] FBgn0026318
Click on [?] for more information.