NP_001027810.1 (Ciona intestinalis)
Description [+]
- Synonyms: NP_001027810.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Urochordata; Ciona intestinalis
- Short gene description: peroxiredoxin-like [Source:RefSeq_peptide;Acc:NP_001027810]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001027810.1-C_intestinalis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | AhpC-TSA | 8 | 141 |
PFAM A | 1-cysPrx_C | 151 | 194 |
Protein sequence [+]
NP_001027810.1 | Ciona intestinalis | 7719 | length:197
MSAGKACIQKSAPDFTATAVVNGDFRDISLSEYKGKYVVLFFYPLDFTFVCPTEIIAFSD
RVSEFRDIGCEVLACSTDSHFSHLAWTNIPRKKGGIGNMKIPLIADKNCAISKDYGVLME
GSGIAFRGLFIIDTMGILRQITINDLPVGRSVDETLRLVKAFQFTDQHGEVCPAGWKPGD
DTIKPDVQDSQKYFSKQ
RVSEFRDIGCEVLACSTDSHFSHLAWTNIPRKKGGIGNMKIPLIADKNCAISKDYGVLME
GSGIAFRGLFIIDTMGILRQITINDLPVGRSVDETLRLVKAFQFTDQHGEVCPAGWKPGD
DTIKPDVQDSQKYFSKQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0004601 | peroxidase activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCING00000003002
- Expression info from Arrayexpress [?] : ENSCING00000003002
- Protein expression from Protein Atlas: [?] ENSCING00000003002
- entrezgene: 493870
- refseq_dna: NM_001032638
- refseq_peptide: NP_001027810
Click on [?] for more information.