BNIP3L (Canis lupus familiaris)
Description [+]
- Synonyms: BNIP3L
- Species: Canis lupus familiaris
- Short gene description: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (NIP3-like protein X)(NIP3L)(BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A)(Adenovirus E1B19K-binding protein B5) [Source:UniProtKB/Swiss-Prot;Acc:O60238]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BNIP3L-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BNIP3 | 31 | 224 |
Protein sequence [+]
BNIP3L | Canis lupus familiaris | 9615 | length:224
WICFEARQNSYQNSPHSHLHMTEFGSAVVNLSYLTCPTGSWVELPMNSSNGNDNGNGKNG
GLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRASSHCDSPSPQEDGQIMFDVEMHTSRD
HSSQSEEEAAEGEKEVDALKKSVDWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAM
KKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
GLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRASSHCDSPSPQEDGQIMFDVEMHTSRD
HSSQSEEEAAEGEKEVDALKKSVDWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAM
KKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0051607 | defense response to virus | biological_proccess | IEA |
GO:0008634 | negative regulation of survival gene product expression | biological_proccess | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0005521 | lamin binding | mollecular_function | IEA |
GO:0005740 | mitochondrial envelope | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005635 | nuclear envelope | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000025105
- Expression info from Arrayexpress [?] : ENSCAFG00000025105
- Protein expression from Protein Atlas: [?] ENSCAFG00000025105
- entrezgene: 608552
Click on [?] for more information.