Q005W6_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: Q005W6_CANFA
- Species: Canis lupus familiaris
- Short gene description: BNIP3 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q005W6]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q005W6_CANFA-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BNIP3 | 52 | 245 |
Protein sequence [+]
Q005W6_CANFA | Canis lupus familiaris | 9615 | length:245
GHCRLSTALSPGAPRGRAPRVKAVLIPEQKQNRPVPGRGRRAPAQRRPSDAMSHSGTPGL
QEENLQGSWVELHFSNNGNGSSVPASASIYNGDLEKILLDAQHESGRSSSKSSHCDSPPR
SQTPQDTTRASEVDTHSIGEKNSSQSEEDYIERRKEVESILKKNSDWIWDWSSRPENIPP
KELLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTT
STSTF
QEENLQGSWVELHFSNNGNGSSVPASASIYNGDLEKILLDAQHESGRSSSKSSHCDSPPR
SQTPQDTTRASEVDTHSIGEKNSSQSEEDYIERRKEVESILKKNSDWIWDWSSRPENIPP
KELLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTT
STSTF
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
GO:0006338 | chromatin remodeling | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0008634 | negative regulation of survival gene product expression | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0045837 | negative regulation of membrane potential | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0051607 | defense response to virus | biological_proccess | IEA |
GO:0050873 | brown fat cell differentiation | biological_proccess | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0005635 | nuclear envelope | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005740 | mitochondrial envelope | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031307 | integral to mitochondrial outer membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000024645
- Expression info from Arrayexpress [?] : ENSCAFG00000024645
- Protein expression from Protein Atlas: [?] ENSCAFG00000024645
- entrezgene: 607408
Click on [?] for more information.