CRADD (Canis lupus familiaris)
Description [+]
- Synonyms: CRADD
- Species: Canis lupus familiaris
- Short gene description: Death domain-containing protein CRADD (Caspase and RIP adapter with death domain)(RIP-associated protein with a death domain) [Source:UniProtKB/Swiss-Prot;Acc:P78560]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CRADD-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 6 | 89 |
| PFAM A | Death | 117 | 198 |
Protein sequence [+]
CRADD | Canis lupus familiaris | 9615 | length:199
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGVLTENHLQEIKAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREEAITELPADDWMTGFPPHILNSSPSDRQI
NQLAQRLGPEWEPVVLALGLSQTDIYRCKANHPHNVQSQMVEAFIRWRQRYGKQATFWSL
YRGLQAVEVDPSVLQDMLE
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREEAITELPADDWMTGFPPHILNSSPSDRQI
NQLAQRLGPEWEPVVLALGLSQTDIYRCKANHPHNVQSQMVEAFIRWRQRYGKQATFWSL
YRGLQAVEVDPSVLQDMLE
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006917 | induction of apoptosis | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0070513 | death domain binding | mollecular_function | IEA |
| GO:0002020 | protease binding | mollecular_function | IEA |
| GO:0030674 | protein binding, bridging | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000006182
- Expression info from Arrayexpress [?] : ENSCAFG00000006182
- Protein expression from Protein Atlas: [?] ENSCAFG00000006182
- entrezgene: 482604
Click on [?] for more information.
