PRDX1 (Canis lupus familiaris)
Description [+]
- Synonyms: PRDX1
- Species: Canis lupus familiaris
- Short gene description: Peroxiredoxin-1 (EC 1.11.1.15)(Thioredoxin peroxidase 2)(Thioredoxin-dependent peroxide reductase 2)(Proliferation-associated gene protein)(PAG)(Natural killer cell-enhancing factor A)(NKEF-A) [Source:UniProtKB/Swiss-Prot;Acc:Q06830]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX1-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 163 |
PFAM A | AhpC-TSA | 8 | 142 |
PFAM A | 1-cysPrx_C | 152 | 195 |
Protein sequence [+]
PRDX1 | Canis lupus familiaris | 9615 | length:199
MSSGNAKIGHPAPNFKATAVMPDGQFKDLSLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
DRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0000302 | response to reactive oxygen species | biological_proccess | IEA |
GO:0019430 | removal of superoxide radicals | biological_proccess | IEA |
GO:0034101 | erythrocyte homeostasis | biological_proccess | IEA |
GO:0032872 | regulation of stress-activated MAPK cascade | biological_proccess | IEA |
GO:0042267 | natural killer cell mediated cytotoxicity | biological_proccess | IEA |
GO:0042345 | regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000004567
- Expression info from Arrayexpress [?] : ENSCAFG00000004567
- Protein expression from Protein Atlas: [?] ENSCAFG00000004567
Click on [?] for more information.