Y97E10AL.3 (Caenorhabditis elegans)
Description [+]
- Synonyms: Y97E10AL.3
- Species: Metazoa;Bilateria;Ecdysozoa;Nematoda; Caenorhabditis elegans
- Short gene description: Y97E10AL.3 [Source:RefSeq_peptide;Acc:NP_505053]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Y97E10AL.3-C_elegans
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Acetyltransf_1 | 47 | 127 |
Protein sequence [+]
Y97E10AL.3 | Caenorhabditis elegans | 6239 | length:173
MTTLRPFDVMDMFKFNNVNLDINTETYGFQFYLHYMMNYPEYYQVAEHPNGEIMAYVMGK
IEGRDTNWHGHVTALSVAPNFRRLGLAAYMMEFLERTSEARRAYFVDLFVRVSNKIAIEL
YKKLGYVVYRQIIGYYTGDRDEDAFDMRKSLSRDPEKKAMVPLNYLVHSRDVD
IEGRDTNWHGHVTALSVAPNFRRLGLAAYMMEFLERTSEARRAYFVDLFVRVSNKIAIEL
YKKLGYVVYRQIIGYYTGDRDEDAFDMRKSLSRDPEKKAMVPLNYLVHSRDVD
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Information from other databases [+]
- Gene info from Wormbase [?] Y97E10AL.3
- Ensembl genome browser [?] : Y97E10AL.3
- Expression info from Arrayexpress [?] : Y97E10AL.3
- Protein expression from Protein Atlas: [?] Y97E10AL.3
Click on [?] for more information.