WAH-1 (Caenorhabditis elegans)
Description [+]
- Synonyms: WAH-1
- Species: Metazoa;Bilateria;Ecdysozoa;Nematoda; Caenorhabditis elegans
- Short gene description: wah-1 encodes a putative flavin-adenine dinucleotide (FAD)-binding oxidoreductase orthologous to mammalian PDCD8 (AIF. OMIM:300169, mutated in Harlequin mice). WAH-1 is required for apoptotic DNA degratation, SCRM-1 phospholipid scramblase activity, phosphatidylserine exposure, rapid apoptosis during embryonic development, and rapid engulfment of apoptotic cells in the germline. WAH-1 is also required for normally rapid growth and large brood sizes, and has a subtle proapoptotic function revealed in ced-3 or ced-4 mutant backgrounds. WAH-1 is expressed in most, if not all, cells of embryos and larvae. WAH-1 is normally mitochondrial, but can be released into the cytosol and nucleus by EGL-1 and CED-3. residues 380-550 of WAH-1 specifically bind SCRM-1 in vitro, but not SCRM-2 through SCRM-4, and WAH-1 binding is required in liposomes for more than residual SCRM-1 activity. WAH-1 also binds and activates CPS-6, promoting apoptotic DNA degradation, and transgenic coexpression of WAH-1 with CPS-6 specifically induces ectopic CED-3-dependent apoptosis in touch receptor neurons. CPS-6 shares a genetic pathway with WAH-1, whereas CED-3, CED-4, CED-8, and NUC-1 act independently of it. WAH-1 is paralogous to C. elegans F20D6.11 and human AIFM3 (AIFL). [Source: WormBase]
- Family: other
- Process: apoptosis,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): AIF
- WIKI: WAH-1-C_elegans
References [+]
- Mechanisms of AIF-mediated apoptotic DNA degradation in Caenorhabditis elegans.
- Wang X, Yang C, Chai J, Shi Y, Xue D
- Apoptosis-inducing factor (AIF), a mitochondrial oxidoreductase, is released into the cytoplasm to induce cell death in response to apoptotic signals. However, the mechanisms underlying this process have not been resolved. We report that inactivation of the Caenorhabditis elegans AIF homolog wah-1 by RNA interference delayed the normal progression of apoptosis and caused a defect in apoptotic DNA degradation. WAH-1 localized in C. elegans mitochondria and was released into the cytosol and nucleus by the BH3-domain protein EGL-1 in a caspase (CED-3)-dependent manner. In addition, WAH-1 associated and cooperated with the mitochondrial endonuclease CPS-6/endonuclease G (EndoG) to promote DNA degradation and apoptosis. Thus, AIF and EndoG define a single, mitochondria-initiated apoptotic DNA degradation pathway that is conserved between C. elegans and mammals. Science. 2002 Nov 22;298(5598):1587-92.
- References from Human ortholog(s):
- Molecular characterization of mitochondrial apoptosis-inducing factor.
- Susin SA, Lorenzo HK, Zamzami N, Marzo I, Snow BE, Brothers GM, Mangion J, Jacotot E, Costantini P, Loeffler M, Larochette N, Goodlett DR, Aebersold R, Siderovski DP, Penninger JM, Kroemer G
- Mitochondria play a key part in the regulation of apoptosis (cell death). Their intermembrane space contains several proteins that are liberated through the outer membrane in order to participate in the degradation phase of apoptosis. Here we report the identification and cloning of an apoptosis-inducing factor, AIF, which is sufficient to induce apoptosis of isolated nuclei. AIF is a flavoprotein of relative molecular mass 57,000 which shares homology with the bacterial oxidoreductases; it is normally confined to mitochondria but translocates to the nucleus when apoptosis is induced. Recombinant AIF causes chromatin condensation in isolated nuclei and large-scale fragmentation of DNA. It induces purified mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Microinjection of AIF into the cytoplasm of intact cells induces condensation of chromatin, dissipation of the mitochondrial transmembrane potential, and exposure of phosphatidylserine in the plasma membrane. None of these effects is prevented by the wide-ranging caspase inhibitor known as Z-VAD.fmk. Overexpression of Bcl-2, which controls the opening of mitochondrial permeability transition pores, prevents the release of AIF from the mitochondrion but does not affect its apoptogenic activity. These results indicate that AIF is a mitochondrial effector of apoptotic cell death. Nature. 1999 Feb 4;397(6718):441-6.
- AIF deficiency compromises oxidative phosphorylation.
- Vahsen N, Cande C, Briere JJ, Benit P, Joza N, Larochette N, Mastroberardino PG, Pequignot MO, Casares N, Lazar V, Feraud O, Debili N, Wissing S, Engelhardt S, Madeo F, Piacentini M, Penninger JM, Schagger H, Rustin P, Kroemer G
- Apoptosis-inducing factor (AIF) is a mitochondrial flavoprotein that, after apoptosis induction, translocates to the nucleus where it participates in apoptotic chromatinolysis. Here, we show that human or mouse cells lacking AIF as a result of homologous recombination or small interfering RNA exhibit high lactate production and enhanced dependency on glycolytic ATP generation, due to severe reduction of respiratory chain complex I activity. Although AIF itself is not a part of complex I, AIF-deficient cells exhibit a reduced content of complex I and of its components, pointing to a role of AIF in the biogenesis and/or maintenance of this polyprotein complex. Harlequin mice with reduced AIF expression due to a retroviral insertion into the AIF gene also manifest a reduced oxidative phosphorylation (OXPHOS) in the retina and in the brain, correlating with reduced expression of complex I subunits, retinal degeneration, and neuronal defects. Altogether, these data point to a role of AIF in OXPHOS and emphasize the dual role of AIF in life and death. EMBO J. 2004 Nov 24;23(23):4679-89. Epub 2004 Nov 4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pyr_redox_2 | 241 | 553 |
PFAM A | Pyr_redox | 412 | 508 |
Protein sequence [+]
wah-1 | Caenorhabditis elegans | 6239 | length:700
MLLRAVGRQMTSVIFRQQTAVRSIAMSRVALGGGGHHHEPTPVYIPKPGSLDWTFFSRSH
TKSAHEFEPYKPEIGAFIGAVAFIGLTLIAVVIKTDVFKKEDSHGHGHGHAKHSKKHEEK
HEQKHEEKEHAEPEKKEEAKPEKPAEPKEPEPAQKQAEQPEQAEEKQETKDAEPKEQVDD
RQTEEAVHARRAPAAAEEPAPSTSKADAVEEKRSEQQSMKPSESTEENTTTTSADGLLHC
EYVIIGSGTAAYYASLSIRAKQAEAKVLMIGEEPELPYNRPPLSKELWWYGDETSATKLA
YTPLSGKKRDIFYEVDGFFVSPEDLPKAVHGGVALLRGRKAVKICEEDKKVILEDGTTIG
YDKLLIATGVRPKKEQVFEEASEEAKQKITYFHYPADFKRVERGLADKSVQKVTIIGNGL
LASELSYSIKRKYGENVEVHQVFEEKYPAEDILPEHIAQKSIEAIRKGGVDVRAEQKVEG
VRKCCKNVVLKLSDGSELRTDLVVVATGEEPNSEIIEASGLKIDEKLGGVRADKCLKVGE
NVWAAGAIATFEDGVLGARRVSSWENAQISGRLAGENMATAAADGKSEGKAFWYQPSFFT
KFAPHLHINAIGKCDSSLETVSVHAEPDKDTPLEKAVVFYKSKEDGSIVGVLLLNVFGPS
LDVARRIIDDRKKVDEYKEIAKLFPLYDPVKSDEDDAKSA
TKSAHEFEPYKPEIGAFIGAVAFIGLTLIAVVIKTDVFKKEDSHGHGHGHAKHSKKHEEK
HEQKHEEKEHAEPEKKEEAKPEKPAEPKEPEPAQKQAEQPEQAEEKQETKDAEPKEQVDD
RQTEEAVHARRAPAAAEEPAPSTSKADAVEEKRSEQQSMKPSESTEENTTTTSADGLLHC
EYVIIGSGTAAYYASLSIRAKQAEAKVLMIGEEPELPYNRPPLSKELWWYGDETSATKLA
YTPLSGKKRDIFYEVDGFFVSPEDLPKAVHGGVALLRGRKAVKICEEDKKVILEDGTTIG
YDKLLIATGVRPKKEQVFEEASEEAKQKITYFHYPADFKRVERGLADKSVQKVTIIGNGL
LASELSYSIKRKYGENVEVHQVFEEKYPAEDILPEHIAQKSIEAIRKGGVDVRAEQKVEG
VRKCCKNVVLKLSDGSELRTDLVVVATGEEPNSEIIEASGLKIDEKLGGVRADKCLKVGE
NVWAAGAIATFEDGVLGARRVSSWENAQISGRLAGENMATAAADGKSEGKAFWYQPSFFT
KFAPHLHINAIGKCDSSLETVSVHAEPDKDTPLEKAVVFYKSKEDGSIVGVLLLNVFGPS
LDVARRIIDDRKKVDEYKEIAKLFPLYDPVKSDEDDAKSA
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL002016-PA | orthology | Aedes |
A_gambiae_AGAP008044-PA | orthology | Anopheles |
NP_001007491.1 | orthology | Chicken |
AIFM1 | orthology | Chimpanzee |
C_intestinalis_ENSCINP00000012225 | orthology | Ciona |
IPI00712659.1 | orthology | Cow |
AIFM1 | orthology | Dog |
CG7263 | orthology | Fly |
AIFM1 | orthology | Fugu |
AIFM1 | orthology | Gasterosteus |
AIFM1 | orthology | Gorilla |
AIFM1 | orthology | Horse |
AIF | orthology | Human |
AIFM1 | orthology | Lyzard |
AIFM1 | orthology | Macaca |
AIFM1 | orthology | Medaka |
AIFM1 | orthology | Monodelphis |
Aifm1 | orthology | Mouse |
AIFM1 | orthology | Orangutan |
AIFM1 | orthology | Rabbit |
Pdcd8 | orthology | Rat |
AIFM1 | orthology | Tetraodon |
pdcd8 | orthology | Xenopus |
T_guttata_ENSTGUP00000005365 | orthology | Zebra finch |
T_guttata_ENSTGUP00000016816 | orthology | Zebra finch |
pdcd8 | orthology | Zebrafish |
A_aegypti_AAEL011158-PA | paralogy | Aedes |
G_gallus_ENSGALP00000039047 | paralogy | Chicken |
AIFM3 | paralogy | Chicken |
AIFM3 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000015763 | paralogy | Ciona |
Q2KJ59_BOVIN | paralogy | Cow |
CG4199 | paralogy | Fly |
CG10700 | paralogy | Fly |
T_rubripes_ENSTRUP00000030429 | paralogy | Fugu |
T_rubripes_ENSTRUP00000040612 | paralogy | Fugu |
AIFM3 | paralogy | Fugu |
G_aculeatus_ENSGACP00000011210 | paralogy | Gasterosteus |
AIFM3 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000027082 | paralogy | Gasterosteus |
AIFM3 | paralogy | Human |
AIFM3 | paralogy | Lyzard |
A_carolinensis_ENSACAP00000014484 | paralogy | Lyzard |
AIFM3 | paralogy | Macaca |
O_latipes_ENSORLP00000003241 | paralogy | Medaka |
AIFM3 | paralogy | Medaka |
O_latipes_ENSORLP00000010037 | paralogy | Medaka |
Aifm3 | paralogy | Mouse |
AIFM3 | paralogy | Orangutan |
RGD1306028 | paralogy | Rat |
AIFM3 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000019217 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000021125 | paralogy | Tetraodon |
F20D6.11 | paralogy | Worm |
AIFM3 | paralogy | Xenopus |
AIFM3 | paralogy | Zebra finch |
LOC569177 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.