CED-9 (Caenorhabditis elegans)
Description [+]
- Synonyms: CED-9
- Species: Metazoa;Bilateria;Ecdysozoa;Nematoda; Caenorhabditis elegans
- Short gene description: ced-9 encodes the sole C. elegans homolog of the mammalian cell-death inhibitor Bcl-2. during development, CED-9 activity is essential for preventing cells from undergoing programmed cell death and CED-9 functions by binding and repressing the activity of CED-4, a protein similar to human APAF-1 that positively regulates CED-3 caspase activity. CED-9 localizes to mitochondria. [Source: WormBase]
- Family: Bcl-2 family : multidomain Bcl-2
- Process: apoptosis,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): BCL2L2
- WIKI: CED-9-C_elegans
References [+]
- Caenorhabditis elegans gene ced-9 protects cells from programmed cell death.
- Hengartner MO, Ellis RE, Horvitz HR
- The gene ced-9 of the nematode Caenorhabditis elegans acts to protect cells from programmed cell death. A mutation that abnormally activates ced-9 prevents the cell deaths that occur during normal C. elegans development. Conversely, mutations that inactivate ced-9 cause cells that normally live to undergo programmed cell death; these mutations result in embryonic lethality, indicating that ced-9 function is essential for development. The ced-9 gene functions by negatively regulating the activities of other genes that are required for the process of programmed cell death. Nature. 1992 Apr 9;356(6369):494-9.
- References from Human ortholog(s):
- bcl-w, a novel member of the bcl-2 family, promotes cell survival.
- Gibson L, Holmgreen SP, Huang DC, Bernard O, Copeland NG, Jenkins NA, Sutherland GR, Baker E, Adams JM, Cory S
- The prototypic mammalian regulator of cell death is bcl-2, the oncogene implicated in the development of human follicular lymphoma. Several homologues of bcl-2 are now known. Using a PCR-based strategy we cloned a novel member of this gene family, denoted bcl-w. The gene, which is highly conserved between mouse and human, resides near the T-cell antigen receptor alpha gene within the central portion of mouse chromosome 14 and on human chromosome 14 at band q11. Enforced expression of bcl-w rendered lymphoid and myeloid cells refractory to several (but not all) cytotoxic conditions. Thus, like Bcl-2 and Bcl-x, the Bcl-w protein promotes cell survival, in contrast to other close homologues, Bax and Bak, which facilitate cell death. Comparison of the expected amino acid sequence of Bcl-w with that of these relatives helps to delineate residues likely to convey survival or anti-survival function. While expression of bcl-w was uncommon in B or T lymphoid cell lines, the mRNA was observed in almost all murine myeloid cell lines analysed and in a wide range of tissues. These findings suggest that bcl-w participates in the control of apoptosis in multiple cell types. Its functional similarity to bcl-2 also makes it an attractive candidate proto-oncogene. Oncogene. 1996 Aug 15;13(4):665-75.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 76 | 102 |
PFAM A | Bcl-2 | 116 | 221 |
Protein sequence [+]
ced-9 | Caenorhabditis elegans | 6239 | length:280
MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRM
SIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMG
TIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGF
VAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEA
EKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK
SIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMG
TIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGF
VAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEA
EKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
BCL2L2 | orthology | Chimpanzee |
BCLW_BOVIN | orthology | Cow |
BCL2L2 | orthology | Gorilla |
BCL2L2 | orthology | Horse |
BCL2L2 | orthology | Human |
BCL2L2 | orthology | Macaca |
M_domestica_ENSMODP00000005598 | orthology | Monodelphis |
Bcl2l2 | orthology | Mouse |
BCL2L1 (2 of 3) | orthology | Tetraodon |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008270 | zinc ion binding | mollecular_function | IEA |
Check GO Evidence Codes here