NP_001092329.1 (Bos taurus)
Description [+]
- Synonyms: NP_001092329.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Fas ligand [Source:RefSeq peptide;Acc:NP_001092329]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001092329.1-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 156 | 277 |
Protein sequence [+]
NP_001092329.1 | Bos taurus | 9913 | length:277
MQQPLNYPYPPIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPPPPPTLPPPPPLP
PLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHTA
SSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSIPLEWEDTYGIALVSGVKYKKGSLVIN
ETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
PLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHTA
SSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSIPLEWEDTYGIALVSGVKYKKGSLVIN
ETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000032808
- Expression info from Arrayexpress [?] : ENSBTAG00000032808
- Protein expression from Protein Atlas: [?] ENSBTAG00000032808
- entrezgene: 785839
- entrezgene: 784352
- entrezgene: 407111
- refseq_dna: NM_001098859
- refseq_peptide: NP_001092329
Click on [?] for more information.