IPI00688117.2 (Bos taurus)
Description [+]
- Synonyms: IPI00688117.2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: IPI00688117.2-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 22 | 245 |
Protein sequence [+]
IPI00688117.2 | Bos taurus | 9913 | length:246
ESKEMSSPQPLEEETYDMSGARLALTLCVTKAREGSEADLDALERMFQQLGFESTMKRDP
TAQQFQEELEKFQQAIDAREDFVSCAFVVLMAHGLEGRLKGKDEKMVELEDLFQALNNKN
CRALRAKPKVYIVQACRGEQRDPGEPVTGGHLVMITENTPETIPTYTDTLHVFSTIEGYI
AYRHDQEGSYFIQTLVDVFINKKGPILELLTEVTRRMAEAEMVQEGEAKKVNPEIQSTLR
KQLYLQ
TAQQFQEELEKFQQAIDAREDFVSCAFVVLMAHGLEGRLKGKDEKMVELEDLFQALNNKN
CRALRAKPKVYIVQACRGEQRDPGEPVTGGHLVMITENTPETIPTYTDTLHVFSTIEGYI
AYRHDQEGSYFIQTLVDVFINKKGPILELLTEVTRRMAEAEMVQEGEAKKVNPEIQSTLR
KQLYLQ
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000021106
- Expression info from Arrayexpress [?] : ENSBTAG00000021106
- Protein expression from Protein Atlas: [?] ENSBTAG00000021106
- entrezgene: 517658
Click on [?] for more information.