FADD_BOVIN (Bos taurus)
Description [+]
- Synonyms: FADD_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Protein FADD (FAS-associated death domain protein)(FAS-associating death domain-containing protein) [Source:UniProtKB/Swiss-Prot;Acc:Q645M6]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FADD_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | DED | 4 | 87 |
| PFAM A | Death | 98 | 181 |
Protein sequence [+]
FADD_BOVIN | Bos taurus | 9913 | length:209
MDPFLVLLHSVSAGLSSSDLTQLKFLCQNHISKRKLELAQSGLDLFTVLLQQNELNAEHT
ALLRELLCSLRRKDLLLRLDDFERGAAGGAAPEDRDLRAAMEIICDNVGKDWRRLARHLG
VSDVKIEAIEEKYPRNLAEQVRELLRVWKNSTRENAAVSCLVGALRGCQLNVVADLIEED
QRARALQSGSANPGSFTAWDSGSAAPGAS
ALLRELLCSLRRKDLLLRLDDFERGAAGGAAPEDRDLRAAMEIICDNVGKDWRRLARHLG
VSDVKIEAIEEKYPRNLAEQVRELLRVWKNSTRENAAVSCLVGALRGCQLNVVADLIEED
QRARALQSGSANPGSFTAWDSGSAAPGAS
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
| GO:0070265 | necrotic cell death | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0042802 | identical protein binding | mollecular_function | IEA |
| GO:0031264 | death-inducing signaling complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000018274
- Expression info from Arrayexpress [?] : ENSBTAG00000018274
- Protein expression from Protein Atlas: [?] ENSBTAG00000018274
- entrezgene: 493720
- refseq_dna: NM_001007816
- refseq_peptide: NP_001007817
Click on [?] for more information.
