TNFB_BOVIN (Bos taurus)
Description [+]
- Synonyms: TNFB_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Lymphotoxin-alpha Precursor (LT-alpha)(TNF-beta)(Tumor necrosis factor ligand superfamily member 1) [Source:UniProtKB/Swiss-Prot;Acc:Q06600]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFB_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 76 | 204 |
Protein sequence [+]
TNFB_BOVIN | Bos taurus | 9913 | length:204
MTPPGRLYLLRVCSTPPLLLLGLLLALPLEAQGLRGIGLTPSAAQPAHQQLPTPFTRGTL
KPAAHLVGDPSTQDSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGRGCF
PRATPTPLYLAHEVQLFSPQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTRGDQL
STHTDGISHLLLSPSSVFFGAFAL
KPAAHLVGDPSTQDSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGRGCF
PRATPTPLYLAHEVQLFSPQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTRGDQL
STHTDGISHLLLSPSSVFFGAFAL
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0006959 | humoral immune response | biological_proccess | IEA |
| GO:0048535 | lymph node development | biological_proccess | IEA |
| GO:0005125 | cytokine activity | mollecular_function | IEA |
| GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005615 | extracellular space | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000000016
- Expression info from Arrayexpress [?] : ENSBTAG00000000016
- Protein expression from Protein Atlas: [?] ENSBTAG00000000016
- entrezgene: 280845
- refseq_dna: NM_001013401
- refseq_peptide: NP_001013419
Click on [?] for more information.
