ENSACAG00000001923 (Anolis carolinensis)
Description [+]
- Synonyms:
- Species: Anolis carolinensis
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -A_carolinensis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 188 | 316 |
Protein sequence [+]
| Anolis carolinensis | 28377 | length:320
MRRASRDYSKYLRGAEELGGGGPHESAPPTPPGPGGAAPQPHAAPAASRTLLAALAVLGL
GQVVCSLALFLYFRAQMDPNRISEEDTHCLRTFLRLQGNIDLQETTLVNQERLMSESCRR
MKQAFQGAMQKEVQRIIIGKDQSRSEKSIMGASWLDLPKINKPDNPPFAHLIIDGNKIPA
GTGKVNLTSWHHDKGWANVVNMTFSDGKLIANHDGFYYLYANVCFRHHEAVGNLTGQTLQ
LMVYVRKTDVKRKNPVVLMKGGSTKNWSGDSEFHFYSVNVGGFFKLKSGEVVSIQVSHPS
LLDRSPEGTYFGAFKVRDID
GQVVCSLALFLYFRAQMDPNRISEEDTHCLRTFLRLQGNIDLQETTLVNQERLMSESCRR
MKQAFQGAMQKEVQRIIIGKDQSRSEKSIMGASWLDLPKINKPDNPPFAHLIIDGNKIPA
GTGKVNLTSWHHDKGWANVVNMTFSDGKLIANHDGFYYLYANVCFRHHEAVGNLTGQTLQ
LMVYVRKTDVKRKNPVVLMKGGSTKNWSGDSEFHFYSVNVGGFFKLKSGEVVSIQVSHPS
LLDRSPEGTYFGAFKVRDID
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0045453 | bone resorption | biological_proccess | IEA |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0045780 | positive regulation of bone resorption | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSACAG00000001923
- Expression info from Arrayexpress [?] : ENSACAG00000001923
- Protein expression from Protein Atlas: [?] ENSACAG00000001923
Click on [?] for more information.